PROTEIN FIELD OF THE INVENTION The present invention relates to improved Pg1B oligosaccharyl transferases and their use in the glycosylation of proteins and/or the production of carrier proteins conjugated to saccharide chains. The invention also includes polynucleotides encoding the improved Pg1B oligosaccharyl transferases and host cells comprising said polynucleotides. BACKGROUND OF THE INVENTION Glycoconjugate vaccines are widely recognized for their ability to prevent many life- threatening bacterial infections. Glycoconjugate vaccines are generally considered efficacious and safe and have been used in humans for over 30 years. Conventional glycovaccine production often involves the chemical modification of immunogenic carrier proteins with polysaccharide antigens of pathogenic bacteria. However, more recently, biotechnological processes for producing glycoconjugate vaccines have emerged that are expected to reduce production costs and to further increase the homogeneity and possibly the potency and safety of glycoconjugate vaccine preparations. In eukaryotic cells, N-linked glycosylation is a key posttranslational protein modification mechanism involving several enzymes. In prokaryotic cells N-linked glycosylation is catalyzed by certain bacterial N-oligosaccharyltransferases (N-OSTs). The protein glycosylation gene cluster of Campylobacter jejuni (C. jejuni) includes the pglB gene, which encodes a membrane-bound N-OST (Pg1B _Cj ). Pg1B can be expressed in standard bacterial hosts, such as Escherichia coli (E. coli), and can glycosylate co-expressed periplasmic proteins that carry at least one surface-exposed D/E-Z1-N-Z2-S/T ( Z1 and Z2 ≠ P) glycosylation motif. Pg1B can transfer bacterial polysaccharide antigens to certain C. jejuni proteins as well as to immunogenic carrier proteins of other organisms containing engineered glycosylation sites. Pg1B can transfer oligosaccharides and, to a certain degree, O-antigen lipopolysaccharide structures of Gram-negative bacteria and capsular antigen polysaccharides of Gram-positive bacteria. However, the efficiency of the oligosaccharyl transferase activity of Pg1B can vary depending on the nature of the saccharide being covalently bonded to a protein containing the required consensus sequence. There is therefore a need for improved Pg1B proteins which are capable of catalyzing the efficient transfer of saccharides with a different structure to those transferred in C. jejuni, to a protein containing the required glycosylation motif. The present disclosure provides engineered Pg1B oligosaccharyltransferases which have been modified to improve the efficiency of Pg1B when transferring a range of saccharides which are not transferred to a protein in a C. jejuni cell. Accordingly, there is provided a Pg1B oligosaccharyltransferase (OST) polypeptide comprising an amino acid sequence that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence set out in SEQ ID NO: 1 or 2 or 3, or a functional fragment thereof, wherein the Pg1B oligosaccharyltransferase polypeptide amino acid sequence includes the feature that: at least one residue selected from the group consisting of amino acid X477, X273, X65, X69, X72, X78, X101, X125, X147, X151, X176, X195, X199, X202, X204, X205, X206, X223, X260, X272, X273, X275, X279, X281, X282, X284, X289, X293, X303, X305, X306, X310, X315, X320, X358, X360, X362, X371, X382, X397, X402, X462, X466, X489, X520, X523, X570 and X605 is substituted to a different amino acid to that found at that position in SEQ ID NO:1 or 2 or suitably 3. In a preferred embodiment, the amino acid sequence is at least 90% identical to SEQ ID NO:1. In a second embodiment there is provided a polynucleotide encoding a mutated Pg1B oligosaccharyltransferase polypeptide of the invention. In a third embodiment there is provided a composition or host cell (for example a prokaryotic host cell or an E. coli host cell) comprising at least one Pg1B oligosaccharyltransferase of the invention or a polynucleotide encoding at least one Pg1B OST of the invention. In a fourth embodiment there is provided process for preparing a glycosylated protein, comprising the steps of: (a) culturing a host cell of the invention, comprising the Pg1B of the invention and/or a polynucleotide encoding the Pg1B of the invention, under conditions suitable for the production of proteins; and Ĩb) isolating the glycosylated protein from the host cell. In a fifth embodiment there is provided an in vitro process for preparing a glycosylated protein, comprising the steps of; i) mixing together: a) a Pg1B oligosaccharyltransferase of the invention; b) a protein comprising at least one glycosylation consensus sequence comprising the amino acid sequence Asp/Glu-Z ₁ -Asn-Z ₂ -Ser/Thr wherein Z ₁ and Z ₂ may be any natural amino acid except Pro; and c) a saccharide chain on a lipid carrier recognised by the Pg1B; ii) incubating under conditions suitable for the enzymatic activity of Pg1B to transfer the saccharide chain to the at least one glycosylation consensus sequence of the protein to achieve a glycosylated protein; and iii) isolating the glycosylated protein. In a sixth embodiment there is provided a glycosylated protein that is made by the process of the invention. In a seventh embodiment there is provided a use of the Pg1B oligosaccharyltransferase or functional fragment thereof of the invention in the production of a glycosylated protein in which a saccharide is attached to an N residue of a glycosylation consensus sequence, comprising the amino acid sequence Asp/Glu-Z ₁ -Asn-Z ₂ -Ser/Thr wherein Z ₁ and Z ₂ may be any natural amino acid except Pro, of a protein to form the glycosylated protein. BRIEF DESCRIPTION OF THE FIGURES Figure 1 - Mutations in Pg1B result in higher oligosaccharyltransferase activity when transferring the capsular saccharide of S pneumoniae serotype 8 to a protein Panel A shows the compounded fold increase of production when Pg1B from round, 1, 2, 3, 4, 5, 6 and 7 are used to transfer the capsular saccharide of S. pneumoniae to an EPA carrier protein. Panel B shows a western blot and a Coomassie stained gel demonstrating the increase in EPA glycosylated with S. pneumoniae serotype 8 saccharide after different rounds of mutation. Figure 2 – The mutated Pg1Bs also have increased activity for transfer of S. pneumoniae serotype 22F to a protein. Panel A shows ELISA results showing increased activity of the round 3, 4 and 5 Pg1Bs in transferring the capsular saccharide of S. pneumoniae serotype 22F to a protein. Panel B shows western blot results of the increase in the production of EPA glycosylated with a serotype 22F capsular saccharide from the Pg1Bs of round 3, 4 and 5. Figure 3 – The mutated Pg1Bs have increased activity for transfer of S. pneumoniae serotypes 23A and 35B to a protein. Panel A shows the results of a coomassie gel and a western blot showing increased glycosylation of EPA with S. pneumoniae serotype 23A polysaccharide when round 4, 5 and 7 Pg1Bs were used to catalyse the transfer. Panel B shows increased glycosylation of EPA when a round 3 Pg1B was used to transfer the capsular saccharide of S. pneumoniae serotype 35B, compared to using wild type Pg1B. Figure 4 – The mutated Pg1Bs have increased activity for transfer of S. pneumoniae serotype 19A to a protein. Coomassie straining and western blot results for the amount of EPA glycosylated with S. pneumoniae serotype 19A using : lane 1 - inactive Pg1B, lane 2 - Pg1B containing Y77R, N311V and H479M mutations, lane 3 – Round 6 Pg1B, Lanes 4-10 – various round 7 Pg1B mutations. Figure 5 – Structure of S. pneumoniae capsular polysaccharide repeat units. Darks circles indicate glucose residues, light circles indicate galactose residues, light circles with “f” inside indicate galactofuranose, dark squares indicate N-acetyl glucosamine, light squares indicate N-acetyl galactosamine, triangles indicate rhamnose, horizontally split diamonds with dark top indicate glucuronic acid, ovals indicate glycerol, stars indicate ribitol, dark squares indicate N-acetyl fucosamine, medium squares indicate N-acetyl mannosamine, diagonally split squares indicate 4-amino-N-acetyl fucosamine and horizontally split diamonds indicate galacturonic acid. Figure 6 – Structure of Group B streptococcus capsular saccharide repeat units. Figure 7 – Mutated Pg1B provides more efficient glycosylation using Streptococcus pneumoniae serotype 1 capsular polysaccharide. SDS-PAGE results for the amount of EPA glycosylated with S. pneumoniae serotype 1 using : lane 1 - inactive Pg1B, lane 2 - Pg1B containing N311V and Y77H mutations, lane 3 – Pg1B containing N311V and Y77R mutations. Figure 8 – Point mutations in Pg1B leading to higher yields of S. sonnei bioconjugates. SDS- PAGE results for the amount of EPA glycosylated with S. sonnei using different Pg1B variants. Purified bioconjugate (10 ^l) was run on an SDS-PAGE and was stained with Instantblue. The left hand side lane shows the yield of a starting point Pg1B and the addition of a point mutation G477A led to a 3.5 fold increase in the yield of bioconjugate as assessed by densitometry. Figure 9 – Further mutations in Pg1B leading to higher yields of S. sonnei bioconjugates. SDS-PAGE results for the amount of EPA glycosylated with S. sonnei using different Pg1B variants. Purified bioconjugate (10 ^l) was run on an SDS-PAGE and was stained with Instantblue. The left hand side lane shows the yield using a starting point Pg1B, the middle lane shows the yield using Pg1B containing point mutations at P195R, I273R, F305D, G477A (5 fold yield increase by densitometry) and the rights lane show the yield using Pg1B containing point mutations at P195R, I273R, D305R and G477S (16 fold yield increase by densitometry). DETAILED DESCRIPTION OF THE INVENTION The present disclosure provides highly efficient Pg1B oligosaccharyltransferases capable of catalyzing the addition of saccharide to a protein containing at least one glycosylation consensus sequence of D/E-Z1-N-Z2-S/T ( Z1 and Z2 ≠ P). Such highly efficient Pg1B oligosaccharyltransferases are achieved by engineering the Pg1B. For example, through the selection of advantageous point mutations, either singly or in combination, which result in increased production of N-glycosylated protein. Assays to confirm the activity of the Pg1B OSTs described herein are well known to skilled artisans (e.g., ELISA, Western Blot) and include the assays described in Examples 2 to 7. In some embodiments, the Pg1B OST is an engineered Pg1B which is optionally expressed in a host cell, optionally a heterologous host cell (i.e. a host cell which is not a Campylobacter cell). The oligosaccharides and polysaccharides can include any oligosaccharide or polysaccharide described herein. The carrier proteins can comprise any carrier protein described herein. In some embodiments, the Pg1B OST comprises modifications (for example amino acids substitutions, or nucleotide substitutions in the polynucleotide encoding Pg1B) in, e.g., two or more, three or more, four or more, five or more, six or more, seven or more, eight or more, nine or more, or ten or more amino acids, for example 2-30, 3-25, 4-20, 5-20, 6-20, 7-20 or 10-20 amino acid substitution. In an embodiment, substitutions are at positions corresponding to the following residues of SEQ ID NO:1: 477; 273; 477 and 273; 195; 195 and 477; 195 and 273; 477, 273 and 195; 305; 305 and 477; 305 and 273; 305 and 195; 477, 305, 273 and 195; 570; 77; 570 and 77, 570, 77 and 311; 125; 125 and 77; 125, 77 and 311; 151; 151 and 77; 151, 77 and 311; 202; 202 and 77; 202, 77 and 311; 204; 204 and 77; 204, 77 and 311; 206; 206 and 77; 206, 77 and 311; 275; 275 and 77; 275, 77 and 311; 462; 462 and 77; 462, 77 and 311; 466; 466 and 77; 466, 77 and 311; 489; 489 and 77; 489, 77 and 311; 57; 77; 57 and 77; 311 and 77; 462 and 479 (mutations at both these positions synergise to increase activity of Pg1B) ;57, 77 and 311; 57 and 462; 57, 462 and 479; 57, 462, 479, 77 and 311; 57, 462, 479, 300, 301, 308 and 570; 57, 462, 479, 300, 301, 308, 570 and 77; 57, 462, 479, 300, 301, 308, 570 , 77 and 311. In an embodiment, the following substitutions are present at positions corresponding to the following residues of SEQ ID NO:1 (where / denotes or): G477A/S; I273R/L; G477A/S and I273L/R; P195R/C/H; P195R/C/H and G477A/S; P195R/C/H and I273R/L; G477A/S, I273R/L and P195R/C/H; F305D/R; F305D/R and G477A/S; F305D/R and I273R/L; F305D/R and P195R/C/H; G477A/S, F305D/R, I273R/L and P195R/C/H; A57R/T; Y77H; A57R/T and Y77H; A57R and Y77H; N311V and Y77H; Y462W and H479M (synergizing mutations); A57R/T, Y77H and N311V; A57R, Y77H and N311V; A57R/T and Y462P/C/W/T/N; A57R /T and Y462W/T/N; A57R and Y462W; Y462P/C/W/T/N and H479M (synergizing mutations); A57R/T, Y462P/C/W/T/N and H479M; A57R/T, Y462W/T/N and H479M; A57R, Y462W and H479M; A57R/T, Y462P/C/W/T/N, H479M, Y77H and N311V; A57R/T, Y462W/T/N, H479M, Y77H and N311V; A57R, Y462W, H479M, Y77H and N311V; A57R/T, Y462P/C/W/T/N, H479M, L301P/G/F and L570R/V; A57R, Y462W, H479M, L301P and L570R; A57R/T, Y462P/C/W/T/N, H479M, N300L, L301P/G/F, F308W/F and L570R/V; A57R, Y462W, H479M, N300L, L301P, F308W and L570R; A57R/T, Y462P/C/W/T/N, H479M, L301P/G/F, L570R/V and Y77H; A57R, Y462W, H479M, L301P ,L570R and Y77H; A57R/T, Y462P/C/W/T/N, H479M, N300L, L301P/G/F, F308W/F, L570R/V and Y77H; A57R, Y462W, H479M, N300L, L301P, F308W, L570R and Y77H; A57R/T, Y462P/C/W/T/N, H479M, L301P/G/F, L570R/V, Y77H and N311V; A57R, Y462W, H479M, L301P ,L570R, Y77H and N311V; A57R/T, Y462P/C/W/T/N, H479M, N300L, L301P/G/F, F308W/F, L570R/V, Y77H and N311V; A57R, Y462W, H479M, N300L, L301P, F308W, L570R, Y77H and N311V; A57R, Y462W, H479M, N300L, L301P, F308W, L570R, Y77H, S80D and N311V; R570G/H/P/Q/S/W/A; R570G/H/P/Q/S/W/A and N311V; R570G/H/P/Q/S/W/A, N311V and Y77H; R570G/H/P/Q/S/W/A, N311V and Y77R; Y151H/C; Y151H/C and N311V; Y151H/C , N311V and Y77H; Y151H/C; Y151H/C and N311V; Y151H/C , N311V and Y77R. In some embodiments, a single point mutation in the engineered Pg1B can increase the efficiency of glycosylation of a carrier protein with a polysaccharide leading to an increase in comparative yield of glycosylated protein. An increase in comparative yield can be determined by dividing the yield of glycosylated protein produced by an engineered Pg1B OST containing a particular amino acid substitution with the yield of glycosylated protein produced by a corresponding Pg1B OST not containing that amino acid substitution. In an embodiment, the introduction of a single point mutation in the engineered Pg1B can increase the comparative yield by between about 1.1-fold and about 10-fold, by between about 1.2-fold and about 7-fold, by between about 1.3-fold and about 5-fold, by between about 1.5-fold and about 2.5-fold or by between about 1.5-fold and about 6-fold compared to the rate of a corresponding Pg1B lacking that particular point mutation. The positive effect of the single point mutations can multiply when combined as multiple point- mutations in a Pg1B. In some embodiments, the engineered Pg1B can contain at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 , 15, 16, 17, 18, 19 or 20 amino acid substitutions that increase the comparative yield of glycosylated protein by more than 2-fold, more than 5- fold, more than 10-fold, more than 50-fold, more than 100-fold, more than 200-fold, more than 500-fold, more than 700-fold, more than 1,000-fold, more than 2,000-fold, more than 3,000-fold, more than 4,000-fold, more than 5,000-fold, more than 6,000-fold, more than 7,000-fold, more than 8,000-fold, more than 10,000-fold, compared to the yield obtained using the corresponding Pg1B in which the combination of point mutations have not been introduced (the original Pg1B). In some embodiments, the yield of protein glycosylation of the engineered Pg1B and the unmutated form of the engineered Pg1B can be compared by comparing the engineered Pg1B’s and the original Pg1B’s glycosylation yield of a protein with a polysaccharide or oligosaccharide lacking an N-acetyl sugar at the reducing end. For example a sugar with a glucose at the reducing end, for example a Streptococcus pneumoniae capsular polysaccharide or a Group B streptococcus capsular saccharide, for example those depicted in Figures 5 and 6. In an embodiment, the polysaccharide or oligosaccharide lacking an N-acetyl sugar at the reducing end is the capsular saccharide of S. pneumoniae serotype 8. The Pg1Bs of the invention are also effective at increasing the comparative yield of glycosylation with other sugars such as S. pneumoniae serotype 1 capsular polysaccharide, S. aureus capsular polysaccharide from serotype 5 or 8 or O-antigens such as those from shigella, for example Shigella sonnei or Shigella flexneri 2a, 3a or 6. Point mutations as residues 315, 125 and 101 are particularly effective in increasing the efficiency of Pg1B in glycosylating a asparagine residue with a Shigella sonnei O-antigen. Point mutations as residues 195, 273, 305 and/or 477 are particularly effective in increasing the efficiency of Pg1B in glycosylating a asparagine residue with a Shigella sonnei O-antigen. In some embodiments, the engineered Pg1B’s glycosylation yield of a protein with a polysaccharide or oligosaccharide lacking an N-acetyl sugar at the reducing end is compared to an unmutated Pg1B’s yield of a glycosylated protein with a polysaccharide or oligosaccharide having an N-acetyl sugar at the reducing end. For example a sugar with a glucose at the reducing end, for example a Streptococcus pneumoniae capsular polysaccharide or a Group B streptococcus capsular saccharide, for example those depicted in Figures 5 and 6 In an embodiment the polysaccharide or oligosaccharide lacking an N-acetyl sugar at the reducing end is the capsular saccharide of S. pneumoniae serotype 8. In some embodiments, the engineered Pg1B’s glycosylation yield of a protein glycosylated with a S. pneumoniae serotype 8 capsular saccharide is increased by at least 1.1-fold, 1.2-fold, 1.3-fold, 1.5-fold, 1.7-fold, 2-fold, 2.5-fold, 3-fold, 5-fold, 10-fold, 100- fold, 500-fold or 1,000-fold relative to an unmutated Pg1B. In some embodiments, the engineered Pg1B can increase the in vivo or in vitro yield of glycosylation of a protein with a S. pneumoniae serotype 8 or 1 capsular saccharide by between about 1.2-fold and about 5,000-fold, by between about 1.5-fold and about 2,000- fold, by between about 2-fold and about 1,000-fold, by between about 2-fold and about 20-fold or by between about 20-fold and about 2,000-fold compared to the yield achieved with an unmutated form of the engineered Pg1B. In some embodiments, the engineered Pg1B can increase the in vivo or in vitro yield of glycosylation of a protein with a S. sonnei O-antigen by between about 1.2-fold and about 200-fold, by between about 1.5-fold and about 100-fold, by between about 2-fold and about 50-fold, by between about 2-fold and about 20-fold or by between about 20-fold and about 2,000-fold compared to the yield achieved with an unmutated form of the engineered Pg1B. In some embodiments, the engineered Pg1B can yield an in vivo glycosylation level or an in vitro glycosylation level of the protein of between about 1% to about 70%, of between about 3% to about 65%, of between about 5% to about 60%, of between about 5% to about 55%, of between about 10% to about 50%, of between about 15% to about 45%, of between about 20% to about 40%, or of between about 25% to about 35%. In some embodiments, the engineered Pg1B can yield an in vivo glycosylation level or an in vitro glycosylation level of the carrier protein of at least 1%, at least 3%, at least 5%, at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, or at least 70%. The engineered Pg1B can be from any organism having a Pg1B. In some embodiments, the engineered Pg1B is from a prokaryotic organism. In some embodiments, the engineered Pg1B is from Campylobacter jejuni (C. jejuni), Campylobacter coli (C. coli), Campylobacter lari (C. lari), Campylobacter upsaliensis (C. upsaliensis), Campylobacter curvus (C. curvus), Campylobacter concisus (C. concisus), Campylobacter hominis (C. hominis), Campylobacter gracilis (C. gracilis), Campylobacter showae (C.showae), Sulfurimonas autotrophica (S. autotrophica), Sulfurimonas denitrificans (S. denitrificans), Sulfurospirillum deleyianum (S. deleyianum), Sulfuricurvum kujiense (S. kujiense), Nautilia profundicola (N. profundicola), Sulfuvorum sp. NBC37-1, Wolinella succinogenes (W. succinogenes), Caminibacter mediatlanticus (C. mediatlanticus), Nitratiruptor sp. SB155-2, Helicobacter pullorum (H.pullorum), Helicobacter Canadensis (H. Canadensis), Helicobacter winghamensis (H. winghamensis), Desulfurobacterium thermolithotr (D. thermolithotr), Desulfomicrobium baculatum (D. baculatum), Desulfovibrio vulgaris (D. vulgaris), Desulfovibrio alkaliphilus (D. alkaliphilus), Desulfohalobium retbaense (D. retbaense), Deferribacter desulfuricans (D. desulfuricans), Desulfovibrio salexigenes (D. salexigenes), Desulfovibrio piger (D. salexigenes), Desulfovibrio aespoeensis (D. aespoeensis), Cand. Puniceispirillum marinum, Calditerrivibrio nitroreducens (C. nitroreducens) or Methanothermus fervidus (M. fervidus). The point mutations identified herein are typically those found in the sequence of Pg1B from C. jejuni (for example Pg1B from C. jejuni of SEQ ID NO:1). A further aspect of the invention is a Pg1B from any of the species identified above containing the corresponding mutation to those disclosed for C. jejuni Pg1B of SEQ ID NO:1. In some embodiments, the Pg1B OST polypeptide is an engineered Pg1B _, an engineered Pg1B homologue or an engineered version of a naturally occurring Pg1B variant. Pg1B _Cj homologues can comprise naturally occurring Pg1B _cj homologues, and non-naturally occurring Pg1B _cj homologues. Pg1B _cj homologues can comprise proteins having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity to a Pg1B _cj of SEQ ID NO:1. The degree of sequence identity may be determined using by the homology alignment algorithm of Needleman and Wunsch, the ClustalW program or the BLASTP algorithm. An algorithm using global alignment (Needleman and Wunsch) is preferred. In some embodiments, the engineered Pg1B is an engineered Pg1BCl, an engineered Pg1BCl homologue or an engineered version of a naturally occurring Pg1B _cl variant. Pg1B _cl homologues can comprise naturally occurring Pg1B _cl homologues, and non-naturally occurring Pg1BCl homologues. Pg1BCl homologues can comprise proteins having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity to a Pg1BCl of SEQ ID NO:3. The degree of sequence identity may be determined by the homology alignment algorithm of Needleman and Wunsch, the ClustalW program or a BLASTP algorithm. An algorithm using global alignment (Needleman and Wunsch) is preferred. In some embodiments, the engineered Pg1B comprises a Pg1B fragment, e.g., a Pg1B _cj fragment. In some embodiments, the Pg1B fragment comprises at least 100, at least 150, at least 200, at least 250, at least 300, at least 350, at least 400, at least 450, at least 500, at least 550, at least 600, or at least 650 contiguous amino acids of a full-length Pg1B for example of SEQ ID NO:1. Pg1B _cj Modifications In some embodiments, the engineered Pg1B OSTs described herein are modified wild-type N-OSTs, e.g., wild-type Pg1B _cj . In some embodiments, the wild-type Pg1B _cj is a wild- type Pg1B _Cj of SEQ ID NO:10, or of a naturally occurring variant thereof: MLKKEYLKNP YLVLFAMIIL AYVFSVFCRF YWVWWASEFN EYFFNNQLMI ISNDGYAFAE GARDMIAGFH QPNDLSYYGS SLSALTYWLY KITPFSFESI ILYMSTFLSS LVVIPTILLA NEYKRPLMGF VAALLASIAN SYYNRTMSGY YDTDMLVIVL PMFILFFMVR MILKKDFFSL IALPLFIGIY LWWYPSSYTL NVALIGLFLI YTLIFHRKEK IFYIAVILSS LTLSNIAWFY QSAIIVILFA LFALEQKRLN FMIIGILGSA TLIFLILSGG VDPILYQLKF YIFRSDESAN LTQGFMYFNV NQTIQEVENV DLSEFMRRIS GSEIVFLFSL FGFVWLLRKH KSMIMALPIL VLGFLALKGG LRFTIYSVPV MALGFGFLLS EFKAIMVKKY SQLTSNVCIV FATILTLAPV FIHIYNYKAP TVFSQNEASL LNQLKNIANR EDYVVTWWDY GYPVRYYSDV KTLVDGGKHL GKDNFFPSFA LSKDEQAAAN MARLSVEYTE KSFYAPQNDI LKTDILQAMM KDYNQSNVDL FLASLSKPDF KIDTPKTRDI YLYMPARMSL IFSTVASFSF INLDTGVLDK PFTFSTAYPL DVKNGEIYLS NGVVLSDDFR SFKIGDNVVS VNSIVEINSI KQGEYKITPI DDKAQFYIFY LKDSAIPYAQ FILMDKTMFN SAYVQMFFLG NYDKNLFDLV INSRDAKVFK LKIYPYDVPD YA In some embodiments, one or more of amino acids X477, X273, X65, X69, X72, X78, X101, X125, X147, X151, X176, X195, X199, X202, X204, X205, X206, X223, X260, X272, X273, X275, X279, X281, X282, X284, X289, X293, X303, X305, X306, X310, X315, X320, X358, X360, X362, X371, X382, X397, X402, X462, X466, X489, X520, X523, X570 and X605 is substituted to a different amino acid to that found at that position of SEQ ID NO:1, or any combination thereof, are modified. In an embodiment, the residue corresponding to amino acid 477 of SEQ ID NO:1 is mutated to a residue that is larger than glycine and aliphatic or polar, for example A or S. In an embodiment, the residue corresponding to amino acid 195 of SEQ ID NO:1 is mutated to a residue that is not a proline for example R, K, H or C, or is basic, for example R or K. In an embodiment, the residue corresponding to amino acid 273 of SEQ ID NO:1 is mutated to a residue that is acidic or basic, for example D, E, K or R. In an embodiment, one or more of X151, X204, X206, X275, X310, X466, X489 and X570, or any combination thereof are modified, for example by substitution. In an embodiment one or more of X311, X77, X57, X462 and X479 are modified. In an embodiment X57 is modified. In an embodiment, X462 and X479 are modified. In an embodiment X57, X462 and X479 are substituted. In an embodiment the A57R substitution is made. In an embodiment A57R, Y462W and H479M substitutions are made. In an embodiment A57R and Y77H substitutions are made. (a) Pg1B _cl Modifications In some embodiments, the modified Pg1B OSTs described herein are modified wild-type Pg1B OSTs, e.g., wild-type Pg1BCl (Pg1B of Campylobacter lari). In some embodiments, the wild-type Pg1B _Cj is a wild-type Pg1B _cl of SEQ ID NO:11, or of a naturally occurring variant thereof: MKLQQNFTDN NSIKYTCILI LIAFAFSVLC RLYWVAWASE FYEFFFNDQL MITTNDGYAF AEGARDMIAG FHQPNDLSYF GSSLSTLTYW LYSILPFSFE SIILYMSAFF ASLIVVPIIL IAREYKLTTY GFIAALLGSI ANSYYNRTMS GYYDTDMLVL VLPMLILLTF IRLTINKDIF TLLLSPVFIM IYLWWYPSSY SLNFAMIGLF GLYTLVFHRK EKIFYLTIAL MIIALSMLAW QYKLALIVLL FAIFAFKEEK INFYMIWALI FISILILHLS GGLDPVLYQL KFYVFKASDV QNLKDAAFMY FNVNETIMEV NTIDPEVFMQ RISSSVLVFI LSFIGFILLC KDHKSMLLAL PMLALGFMAL RAGLRFTIYA VPVMALGFGY FLYAFFNFLE KKQIKLSLRN KNILLILIAF FSISPALMHI YYYKSSTVFT SYEASILNDL KNKAQREDYV VAWWDYGYPI RYYSDVKTLI DGGKHLGKDN FFSSFVLSKE QIPAANMARL SVEYTEKSFK ENYPDVLKAM VKDYNKTSAK DFLESLNDKD FKFDTNKTRD VYIYMPYRML RIMPVVAQFA NTNPDNGEQE KSLFFSQANA IAQDKTTGSV MLDNGVEIIN DFRALKVEGA SIPLKAFVDI ESITNGKFYY NEIDSKAQIY LLFLREYKSF VILDESLYNS SYIQMFLLNQ YDQDLFEQIT NDTRAKIYRL KR In another embodiment, provided herein is an engineered Pg1B _cl comprising an N314V substitution and a Y79R substitution. In a further embodiment, there is provided an engineered Pg1B _cl comprising a A59R mutation. In a further embodiment, there is provided an engineered Pg1BCl comprising a Y468W and a H485M mutation. In a further embodiment, there is provided an engineered Pg1B _cl comprising a A59R, a Y468W and a H485M substitution. In a further embodiment, there is provided an engineered Pg1B _cl comprising a N314V, a Y79R, a A59R, a Y468W and a H485M substitution. Oligosaccharides and Polysaccharides The oligosaccharides that can be linked to a protein by the engineered Pg1B OSTs provided herein can have from about 2 to about 100 monosaccharide units, e.g., 2, 4, 6, 8, 10, 15, 20, 25, 30, 40, 50, 60, 70, 80, 90 or 100 or from 4 to 90, 6 to 80, 8 to 70, 10 to 60, 15 to 50, 20 to 40 or 25 to 40 monosaccharide units. The polysaccharides that can be linked to a protein by the engineered Pg1B OSTs provided herein can have more than 100 monosaccharide units, e.g., at least 101, 110, 150, 200, 300, 400, 500, 600, 700, 800, 900, 1,000 monosaccharide units or more. For example, from 100 to 500, from 100 to 300 or from 100 to 200 monosaccharide units. The proteins or Pg1B OSTs can comprise any Pg1B OST or any protein disclosed herein. In some embodiments, the sugar at the reducing end of the oligosaccharide or polysaccharide is a pentose, hexose, or heptose. In some embodiments, the sugar at the reducing end of the oligosaccharide or polysaccharide is an aldopentose or a ketopentose. In some embodiments, the pentose is a D-arabinose, a D-lyxose, a D-ribose, a D-xylose, a D-ribulose, or a D-Xylulose. In some embodiments, the sugar at the reducing end of the oligosaccharide or polysaccharide is an aldohexose or a ketohexose. In some embodiments, the hexose is, e.g., a D-allose, D-altrose, D-glucose, D-mannose, D-gulose, D-idose, D-galactose, D-talose, D-psicose, D-fructose, D-sorbose or D-tagatose. In some embodiments, the sugar at the reducing end of the oligosaccharide or polysaccharide is a deoxy or a di-deoxy sugar, such as, e.g., a rhamnose, a fucose, or an abequose. In some embodiments, the sugar at the reducing end of the oligosaccharide or polysaccharide is an aldoheptose or a ketoheptose. In some embodiments, the heptose is a mannoheptulose. In some embodiments, the sugar at the reducing end of the oligosaccharide or polysaccharide is a hexNAc sugar. In a preferred embodiment, the sugar at the reducing end of the oligosaccharide of polysaccharide is glucose. In a preferred embodiment, the sugar at the reducing end of the oligosaccharide or polysaccharide is 4-amino-N-acetylfucosamine (e.g. in the case of S. pneumoniae serotype 1 and S. sonnei). In a preferred embodiment, the sugar at the reducing end of the oligosaccharide or polysaccharide is N- acetylfucosamine (e.g. in the case of S. aureus capsular polysaccharide type 5 and 8). The oligosaccharides and polysaccharides that can be linked to a N residue of a protein by the engineered Pg1B OSTs provided herein can be those normally found in any organism, e.g., a prokaryotic organism or a eukaryotic organism. In some embodiments, the oligosaccharide or polysaccharide is from a pathogenic organism, e.g., a human pathogen or an animal pathogen (e.g., a farm animal or a pet). In some embodiments, the oligosaccharide or polysaccharide is from a bacterial organism. In some embodiments, the oligosaccharide or polysaccharide can be from E. coli, Shigella sonnei, Shigella flexneri, Shigella dysenteriae, Salmonella sp (e.g., S. enterica subsp. Enterica, S. enterica subsp. Salamae, S. enterica subsp. arizonae, S. enterica subsp. Diarizonae, S. enterica subsp. Houtenae, S. bongori, and S. enterica subsp. Indica, Pseudomonas sp (P. aeruginosa), Klebsiella sp. (e.g., K. pneumonia), Acinetobacter, Chlamydia trachomatis, Vibrio cholera, Listeria sp., e.g., L. monocytogenes, Legionella pneumophila, Bordetella parapertussis, Burkholderia mallei and pseudomallei, Francisella tularensis, Campylobacter sp. (C. jejuni); Clostridium difficile, Staphylococcus aureus, Streptococcus pneumoniae, Streptococcus pyogenes, E. coli, Streptococcus agalacticae, Neisseria meningitidis, Candida albicans, Haemophilus influenza, Enterococcus faecalis, Borrelia burgdorferi, Neisseria gonorrhoea, Haemophilus influenza, Leishmania major. In some embodiments, the oligosaccharide or polysaccharide comprises an antigen, e.g., an epitope that is immunogenic in a human or an animal (e.g., a farm animal or a pet). In some embodiments, the oligosaccharide or the polysaccharide comprises an O antigen of E. coli (e.g., O1, O2, O3, O4, O5, O6, O7, O8, O9, O10, O11, O12, O13, O14, O15, O16, O17, O18, O19, O20, O21, O22, O23, O24, O25, O26, O27, O28, O29, O30, O32, O33, O34, O35, O36, O37, O38, O39, O40, O41, O42, O43, O44, O45, O46, O48, O49, O50, O51, O52, O53, O54, O55, O56, O57, O58, O59, O60, O61, O62, O63, O64, O65, O66, O68, O69, O70, O71, O73, O74, O75, O76, O77, O78, O79, O80, O81, O82, O83, O84, O85, O86, O87, O88, O89, O90, O91, O92, O93, O95, O96, O97, O98, O99, O100, O101, O102, O103, O104, O105, O106, O107, O108, O109, O110, O111, O112, O113, O114, O115, O116, O117, O118, O119, O120, O121, O123, O124, O125, O126, O127, O128, O129, O130, O131, O132, O133, O134, O135, O136, O137, O138, O139, O140, O141, O142, O143, O144,O145, O146, O147, O148, O149, O150, O151, O152, O153, O154, O155, O156, O157, O158, O159, O160, O161, O162, O163, O164, O165, O166, O167, O168, O169, O170, O171, O172, O173, O174, O175, O176, O177, O178, O179, O180, O181, O182, O183, O184, O185, O186, O187), Shigella flexneri O1A, O1B, O2A, O3A, O6, Shigella sonnei O antigen, Shigella dysenteriae O1, Salmonella sp (S. enterica subsp. Enterica, S. enterica subsp. Salamae, S. enterica subsp. arizonae, S. enterica subsp. diarizonae, S. enterica subsp. houtenae, S. bongori, or S. enterica subsp. indica antigens and O types 1-67, as detailed in [44], Pseudomonas sp. (P. aeruginosa O serotypes 1-20 [45]) , Klebsiella sp. (e.g., K. pneumonia serotypes O1, O2 (and subserotypes), O3, O4, O5, O6, O7, O8, O9, O10, O11, O12, [46]), Acinetobacter O antigens (e.g., A. baumannii O antigens identified in [47]), Chlamydia trachomatis O antigens (serotypes A, B, C, D, E, F, G, H, I J, K, L1, L2, L3), Vibrio cholera O antigens O1 to 155, Listeria sp., in particular L. monocytogenes type 1, 2, 3, 4 and subserotypes thereof, Legionella pneumophila serotypes 1 to 15 O antigens, Bordetella parapertussis O antigens, Burkholderia mallei and pseudomallei O antigens, Francisella tularensis, Campylobacter sp. (C. jejuni); Capsular polysaccharides of Clostridium difficile (serotypes A, G, H, K, S1, S4, D, Cd-5, K Toma et al.1988, and C. perfringens serotypes A, B, C, D or E), Staphylococcus aureus capsular saccharides from serotype 5 or serotype 8, Streptococcus pneumoniae capsular saccharides from serotype 1, 2, 3, 4, 5, 6A, 6B, 6C, 7F, 8, 9A, 9L, 9N, 9V, 10A, 11A, 12F, 14, 15A, 15B, 16F, 18C, 19A, 19F, 22F, 23F, 33F, 35B, Streptococcus pyogenes (group B streptococcus capsular serotype polysaccharides from serotype Ia, Ib, II, III, IV, V, VI, VII, or VIII), Streptococcus agalacticae (group A streptococcal capsular polysaccharides), Neisseria meningitidis (serogroups A, B, C, W, Y, X), Candida albicans, Haemophilus influenza, Enterococcus faecalis capsular polysaccharides type I-V; and other surface polysaccharide structures, e.g., the Borrelia burgdorferi glycolipids , Neisseria meningitidis pilin O glycan and lipooligosaccharide (LOS), Haemophilus influenza LOS, Leishmania major lipophosphoglycan , tumor associated carbohydrate antigens (malaria glycosyl phosphatidylinositol, Mycobacterium tuberculosis arabinomannan. In some embodiments, the oligosaccharide or polysaccharide is a Staphylococcus aureus (S. aureus) or a Salmonella enterica sv. (S. enterica sv.) polysaccharide. In some embodiments, the polysaccharide is a S. aureus CP5 or CP8 or a S. enterica sv. Typhimurium LT2 polysaccharide. In an embodiment, the oligosaccharide or polysaccharide is S. pneumoniae serotype 1 PS. In an embodiment, the oligosaccharide or polysaccharide is Shigella sonnei O antigen. In an embodiment, the oligosaccharide or polysaccharide is S. aureus capsular saccharide serotype 5 or 8 In some embodiments, the oligosaccharide or polysaccharide comprises an N-acetyl sugar at the reducing end. In some embodiments, the oligosaccharide or polysaccharide comprising the N-acetyl sugar at the reducing end can comprise, e.g., an O antigen of E. coli (e.g., O1, O2, O3, O4, O5, O6, O7, O8, O9, O10, O11, O12, O13, O14, O15, O16, O17, O18, O19, , O21, O22, O23, O24, O25, O26, O27, O28, O29, O30, O32, O33, O34, O35, O36, O37, O38, O39, O40, O41, O42, O43, O44, O45, O46, O48, O49, O50, O51, O52, O53, O54, O55, O56, O57, O58, O59, O60, O61, O62, O63, O64, O65, O66, O68, O69, O70, O71, O73, O74, O75, O76, O77, O78, O79, O80, O81, O82, O83, O84, O85, O86, O87, O88, O89, O90, O91, O92, O93, O95, O96, , O98, O99, O100, O101, O102, O103, O104, O105, O106, O107, O108, O109, O110, O111, O112, O113, O114, O115, O116, O117, O118, O119, O120, O121, O123, O124, O125, O126, O127, O128, O129, O130, O131, O132, O133, O134, O135, O136, O137, O138, O139, O140, O141, O142, O143, O144,O145, O146, O147, O148, O149, O150, O151, O152, O153, O154, O155, O156, O157, O158, O159, O160, O161, O162, O163, O164, O165, O166, O167, O168, O169, O170, O171, O172, O173, O174, O175, O176, O177, O178, O179, O180, O181, O182, O183, O184, O185, O186, O187), a capsular polysaccharide of Staphylococcus aureus (S. aureus) (e.g., CP5 or CP8), a capsular polysaccharide of Francisella tularensis Schu4, a capsular polysaccharide of S. pneumoniae capsules (e.g., CP1, 4, 5, 12, 25, 38, 44, 45 or 46), a Neisseria meningitidis pilin O glycan, a Burkholderia mallei and pseudomallei O antigen, a Bordetella parapertussis O antigen, a Legionella pneumophila serotypes 1 to 15 O antigen, a Listeria sp. O antigen, in particular an O antigen of L. monocytogenes type 1, 2, 3, 4, an O antigen of Pseudomonas sp. (P. aeruginosa O serotypes 1-20), an O antigen of Klebsiella sp. (e.g., K. pneumonia serotypes O1, O2 (and subserotypes) O3 O4 O5 O6 O7 O8 O9 O10 O11 O12) an O antigen of Shigella sp (e.g., S. dysenteriae, S. sonnei, S. flexneri, S. boydii), an Acinetobacter O antigen (e.g., A. baumannii O antigens , or an O antigen of Listeria sp. N-acetyl sugars can comprise an amino-acetyl (N-acetyl) substituent at one or more carbon atoms of the sugar. For example, an N-acetyl sugar can comprise an N-acetyl substituent at the C2-atom of a monosaccharide unit, such as a glucose unit (N- acetylglucosamine). In some embodiments, the oligosaccharide or polysaccharide comprises a sugar at the reducing end that is not N-acetylated. In some embodiments, the oligosaccharide or polysaccharide comprising the non-N-acetylated sugar at the reducing end can comprise, e.g., E. coli O20, an antigen of Salmonella sp (e.g., S. enterica subsp. Enterica, S. enterica subsp. Salamae, S. enterica subsp. arizonae, S. enterica subsp. diarizonae, S. enterica subsp. houtenae, S. bongori, or S. enterica subsp. Indica or S. Typhi), an O antigen of type 1-67, a capsular polysaccharide of group A Streptococcus (S. pyrogenes), group B Streptococcus, and of S. pneumoniae CPS serotypes (encoding wchA, wcjG, or wcjH in their capsular gene clusters, i.e. all serotypes except CP1, 4, 5, 12, 25, 38, 44, 45, 46), or a Salmonella enterica sv. (S. enterica sv.) O antigen. In some embodiments, the oligosaccharide or polysaccharide comprises a S. aureus CP5 or CP8 or a S. enterica sv. Typhimurium LT2 polysaccharide, a Vibrio cholera O antigen (e.g., O1 to 155), or a Listeria sp. O antigen (e.g., L. monocytogenes type 1, 2, 3, 4). In some embodiments, the oligosaccharide or polysaccharide comprises a D-N- acetylfucosamine (D-FucNAc) residue at its reducing end, such as, e.g., capsular polysaccharides of S. aureus serotypes 5, 8 or P. aeruginosa O antigen serotypes O2, O5, O11, O16. In some embodiments, the oligosaccharide or polysaccharide comprises a 4-amino-d-N- acetylfucosamine (D-FucNAc4N) residue at its reducing end, such as, e.g., certain oligosaccharides or polysaccharides from S. pneumoniae, like serotype 1, Shigella sonnei O antigen, or Plesiomonas shigelloides O17. In some embodiments, the oligosaccharide or polysaccharide comprises a D-N- acetylquinosamine (D-QuiNAc) residue at its reducing end, such as, e.g., like P. aeruginosa O antigen serotypes O6, O1, or Francisella tularensis serotype Schu4. In some embodiments, the oligosaccharide or polysaccharide comprises a galactose residue at its reducing end, such as, e.g., S. enterica LT2. In some embodiments, the oligosaccharide or polysaccharide comprises a S. pneumoniae capsular polysaccharide serotype 5, E. coli O1, O2, Cronobacter sakazakii O5, i.e., poly- and oligosaccharide with a reducing end D-GlcNAc linked to 1-4 to a L-Rhamnose in beta configuration. Proteins The protein to be glycosylated by an engineered Pg1B OST of the invention is a protein containing at least one N residue situated in a glycosylation consensus sequence D/E-Z ₁ - N-Z2-S/T ( Z1 and Z2 ≠ P). In some embodiments, the protein is a carrier protein. The activity of engineered Pg1B OST is capable of covalently bonding a saccharide immunogen to the carrier protein. The carrier protein provides T-cell epitopes which allow the attached saccharide immunogen to generate a T-dependent immune response. In some embodiments, the protein is a biopharmaceutical protein, to which the engineered Pg1B OST of the invention adds at least one saccharide to achieve correct glycosylation or correct folding or increased stability of the biopharmaceutical protein. In an embodiment , the biopharmaceutical protein is a monoclonal antibody, a fragment of a monoclonal antibody capable of binding to an antigen. In an embodiment, the biopharmaceutical protein is a erythropoietin, growth hormone, human insulin, Factor VIII, Factor IX, tissue plasminogen activator, glucagon, gonadotrophin, colony stimulating factor, interferon ^, ^ or ^, an interleukin e.g. interleukin 2, or tumour necrosis factor. Carrier proteins can be linked to oligosaccharides or polysaccharides by the engineered Pg1B OSTs provided herein. The carrier protein can be any natural carrier protein (from the same organism as the Pg1B OST) or any heterologous carrier protein (from a different organism than the Pg1B OST). In some embodiments, the carrier protein is an immunogen. Carrier proteins can be full- length proteins or fragments thereof. Exemplary carrier proteins comprise, without limitation, exotoxin A of P. aeruginosa (EPA), CRM197, diphtheria toxoid, tetanus toxoid, detoxified hemolysin A of S. aureus, clumping factor A, clumping factor B, E. coli FimH, E. coli FimHC, E. coli heat labile enterotoxin, detoxified variants of E. coli heat labile enterotoxin, Cholera toxin B subunit (CTB), cholera toxin, detoxified variants of cholera toxin, E. coli sat protein, the passenger domain of E. coli sat protein, C. jejuni AcrA, and C. jejuni natural glycoproteins. In some embodiments, the carrier protein is exotoxin A of P. aeruginosa (EPA). In some embodiments, the carrier proteins N-glycosylated by an engineered Pg1B OST described herein are modified, e.g., modified in such a way that the protein is less toxic and or more susceptible to glycosylation, etc. In some embodiments, the carrier proteins are modified such that the number of glycosylation sites in the carrier proteins is maximized in a manner that allows for lower concentrations of the protein to be administered, e.g., in an immunogenic composition, in its bioconjugate form. Accordingly in certain embodiments, the carrier proteins described herein are modified to comprise 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more glycosylation sites than would normally be associated with the carrier protein (e.g., relative to the number of glycosylation sites associated with the carrier protein in its native/natural, e.g., “wild-type” state). In some embodiments, introduction of glycosylation sites is accomplished by insertion of glycosylation consensus sequences (e.g., (i) the consensus sequence Asn-Z-Ser(Thr), wherein Z is are independently selected from any amino acid except Pro; or (ii) the consensus sequence D/E-Z ₁ -N-Z ₂ -S/T, wherein Z ₁ and Z ₂ are independently selected from any amino acid except Pro) anywhere in the primary structure of the protein. Introduction of such glycosylation sites can be accomplished by, e.g., adding new amino acids to the primary structure of the protein (the glycosylation sites are added, in full or in part), or by modifying existing amino acids in the protein in order to generate the glycosylation sites (amino acids are not added to the protein, but selected amino acids of the protein are mutated so as to form glycosylation sites). Those of skill in the art will recognize that the amino acid sequence of a protein can be readily modified using approaches known in the art, e.g., engineered approaches that comprise modification of the nucleic acid sequence encoding the protein. In specific embodiments, glycosylation consensus sequences are introduced into specific regions of the carrier protein, e.g., surface structures of the protein, at the N or C termini of the protein, and/or in loops that are stabilized by disulfide bridges at the base of the protein. In certain embodiments, the classical 5 amino acid glycosylation consensus sequence may be extended by lysine residues for more efficient glycosylation, and thus the inserted consensus sequence may encode 5, 6, or 7 amino acids that should be inserted or that replace acceptor protein amino acids. The Pg1B OSTs can comprise any N-OST disclosed herein. In some embodiments, the carrier proteins comprise a “tag,” a sequence of amino acids that allows for the isolation and/or identification of the carrier protein. For example, adding a tag to a carrier protein described herein can be useful in the purification of that protein and, hence, the purification of conjugate vaccines comprising the tagged carrier protein. Exemplary tags that can be used herein comprise, without limitation, histidine (HIS) tags (e.g., hexa histidine-tag, or 6XHis-Tag), FLAG-TAG, and HA tags. In certain embodiments, the tags used herein are removable, e.g., removal by chemical agents or by enzymatic means, once they are no longer needed, e.g., after the protein has been purified. Nucleic Acids In another aspect, provided herein are polynucleotides encoding a mutated Pg1B oligosaccharyltransferase from any Campylobacter species including C. jejuni, C. lari and C. coli. In some embodiments, the nucleic acids encode an engineered Pg1B _Cj wherein one or more of amino acids X477, X273, X65, X69, X72, X78, X101, X125, X147, X151, X176, X195, X199, X202, X204, X205, X206, X223, X260, X272, X273, X275, X279, X281, X282, X284, X289, X293, X303, X305, X306, X310, X315, X320, X358, X360, X362, X371, X382, X397, X402, X462, X466, X489, X520, X523, X570 and X605 is/are modified, for example by the nucleic acid encoding a different sequence leading to the substitution of one of the above amino acids being substituted for a different amino acid. In an embodiment, there is provided a polynucleotide encoding a Pg1B oligosaccharyltransferase in which the amino acid corresponding to 311 of SEQ ID NO:1 is substituted, for example by a valine residue (N311V). In an embodiment, the 311 substitution is supplemented with a substitution of the amino acid corresponding to 77 in SEQ ID NO:1 , for example by a arginine or histidine residue (Y77R, Y77H). In an embodiment the polynucleotide encoding Pg1B OST has a substitution at the amino acid corresponding to 570 in SEQ ID NO:1, for example by an arginine residue (R570G/H/P/Q/S/W/A). The 570 substitution is either in combination with 311 and 77 substitutions or is independently substituted. In an embodiment, the polynucleotide encodes a Pg1B OST with N311V, Y77R and R57G/H/P/Q/S/W/A substitutions or with N311V, Y77H and R57G/H/P/Q/S/W/A substitutions. In some embodiments, the polynucleotide of the invention encodes a Pg1B OST which comprises modifications (for example amino acids substitutions, or nucleotide substitutions in the polynucleotide encoding Pg1B) in, e.g., two or more, three or more, four or more, five or more, six or more, seven or more, eight or more, nine or more, or ten or more amino acids, for example 2-30, 3-25, 4-20, 5-20, 6-20, 7-20 or 10-20 amino acid substitution. In an embodiment, substitutions are at positions encoding the following residues of SEQ ID NO:1: X477; X273; X477 and X273; X195; X195 and X477; X195 and X273; X477, X273 and X195; X305; X305 and X477; X305 and X273; X305 and X195; X477, X305, X273 and X195; X570; X77; X570 and X77; X311 and X77; X570, X77 and X311; X57 and X462; X57, X462 and X479; X57, X462, X479, X77 and X311; X57, X462, X479, X300, X301, X308 and X570; X57, X462, X479, X300, X301, X308, X570 and X77; X57, X462, X479, X300, X301, X308, X570 , X77 and X311. In an embodiment at least one residue selected from the group consisting of X77, X311, X300, X301, X308, X570, X191, X286, X295, X382, X482, X523, X297, X80, X87 and X477 is substituted compared to the residue found at the corresponding position in SEQ ID NO:1. In an embodiment at least 2, 3, 4, 5, 6, 7, 8, 9 , 10, 11, 12 , 13, 14, 15, 16, 17 or al 18 of the positions are substituted compared to the residue found at the corresponding position of SEQ ID NO:1. In an embodiment, the following substitutions are made: Y77R; N311V; N300L; L301P; F308W; L570R; L191Y; Y286Q; S295L; A382S; K482R; T523R; E297R; S80D; Y87V; G477A. In an embodiment at least one residue selected from the group consisting of amino acid X477, X273, X65, X69, X72, X78, X101, X125, X147, X151, X176, X195, X199, X202, X204, X205, X206, X223, X260, X272, X273, X275, X279, X281, X282, X284, X289, X293, X303, X305, X306, X310, X315, X320, X358, X360, X362, X371, X382, X397, X402, X462, X466, X489, X520, X523, X570 and X605 is substituted to a different amino acid to that found at that position in SEQ ID NO:1. In an embodiment the following substitutions are introduced into SEQ ID NO:1 to produce a variant Pg1B: X311 and X77; X311, X77 and X204; X311, X77 and X489; X311, X77 and X466; X311, X77 and X69. Such Pg1B variant are optionally used for the addition of S. pneumoniae capsular saccharides to a protein containing at least one glycosylation consensus sequence as described herein. In an embodiment, the following substitutions are introduced into SEQ ID NO:1 to produce a variant Pg1B: X311 and X77, X311 , X77 and X477; X311, X77, X477 and X195, X311, X77, X477 and X305; X311, X77, X477 and X305; X311, X77, X477 and X273 or X311, X77, X477, X195, X305 and X273. Such Pg1B variants are optionally used for the addition of S. sonnei O-antigen to a protein containing at least one glycosylation consensus sequence as described herein. In an embodiment, the following substitutions are present at positions encoding the following residues of SEQ ID NO:1 (where / denotes or): G477A/S; I273R/L; G477A/S and I273L/R; P195R/C/H; P195R/C/H and G477A/S; P195R/C/H and I273R/L; G477A/S, I273R/L and P195R/C/H; F305D/R; F305D/R and G477A/S; F305D/R and I273R/L; F305D/R and P195R/C/H; G477A/S, F305D/R, I273R/L and P195R/C/H; A57R/T; Y77H/R; A57R/T and Y77H; A57R and Y77H/R; N311V and Y77H/R; A57R/T, Y77H/R and N311V; A57R, Y77R/H and N311V; A57R/T and Y462P/C/W/T/N; A57R /T and Y462W/T/N; A57R and Y462W; A57R/T, Y462P/C/W/T/N and H479M; A57R/T, Y462W/T/N and H479M; A57R, Y462W and H479M; A57R/T, Y462P/C/W/T/N, H479M, Y77H/R and N311V; A57R/T, Y462W/T/N, H479M, Y77H/R and N311V; A57R, Y462W, H479M, Y77H/R and N311V; A57R/T, Y462P/C/W/T/N, H479M, L301P/G/F and L570R/V; A57R, Y462W, H479M, L301P and L570R; A57R/T, Y462P/C/W/T/N, H479M, N300L, L301P/G/F, F308W/F and L570R/V; A57R, Y462W, H479M, N300L, L301P, F308W and L570R; A57R/T, Y462P/C/W/T/N, H479M, L301P/G/F, L570R/V and Y77H/R; A57R, Y462W, H479M, L301P ,L570R and Y77H/R; A57R/T, Y462P/C/W/T/N, H479M, N300L, L301P/G/F, F308W/F, L570R/V and Y77H/R; A57R, Y462W, H479M, N300L, L301P, F308W, L570R and Y77H/R; A57R/T, Y462P/C/W/T/N, H479M, L301P/G/F, L570R/V, Y77H/R and N311V; A57R, Y462W, H479M, L301P ,L570R, Y77H/R and N311V; A57R/T, Y462P/C/W/T/N, H479M, N300L, L301P/G/F, F308W/F, L570R/V, Y77H/R and N311V; A57R, Y462W, H479M, N300L, L301P, F308W, L570R, Y77H/R and N311V. Host Cells In another aspect, provided herein is a host cell comprising a mutated Pg1B OST or a wild-type or mutated C. coli Pg1B OST provided herein. In an embodiment, the host cell is a heterologous host cell (e.g. not Campylobacter). In an embodiment, the host cell is E. coli. In some embodiments, the host cell comprises two or more engineered Pg1B OSTs provided herein (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10 or more engineered Pg1B OSTs). In another aspect, provided herein is a host cell comprising a nucleic acid provided herein (e.g., encoding an engineered Pg1B OST provided herein). In some embodiments, the host cell comprises two or more nucleic acids provided herein (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10 or more nucleic acids). In some embodiments, the host cell comprises one or more further enzymes useful for bioconjugate production or protein N-glycosylation (e.g., a glycosyltransferase). In some embodiments, at least one of the further enzymes useful for bioconjugate production is a recombinant enzyme. In some embodiments, the host cell comprises two or more further enzymes useful for bioconjugate production (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10 or more further enzymes). In some embodiments, the host cell is a prokaryotic cell. In some embodiments, the host cell is an E. coli cell. In some embodiments, the host cell comprises an engineered Pg1B OST provided herein. In some embodiments, the host cell comprises a protein containing at least one glycosylation consensus sequence and an engineered N-OST provided herein. In some embodiments, the host cell comprises a protein containing at least one glycosylation consensus sequence, an engineered Pg1B OST provided herein, and a recombinant glycosyltransferase. In some embodiments, the engineered Pg1B OST is an engineered C. jejuni Pg1B. In certain embodiments, the host cells used to produce the bioconjugates described herein are engineered to comprise heterologous nucleic acids, e.g., heterologous nucleic acids that encode one or more proteins containing at least one glycosylation consensus sequence and/or heterologous nucleic acids that encode one or more proteins, e.g., genes encoding one or more enzymes. In some embodiments, heterologous nucleic acids that encode proteins involved in glycosylation pathways (e.g., prokaryotic and/or eukaryotic glycosylation pathways) are introduced into the host cells described herein. Such nucleic acids can encode proteins including, without limitation, oligosaccharyl transferases and/or glycosyltransferases. Heterologous nucleic acids (e.g., nucleic acids that encode proteins containing at least one glycosylation consensus sequence and/or nucleic acids that encode other proteins, e.g., proteins involved in glycosylation) can be introduced into the host cells described herein using any methods known to those of skill in the art, e.g., electroporation, chemical transformation by heat shock, natural transformation, phage transduction, and conjugation. In some embodiments, heterologous nucleic acids are introduced into the host cells described herein using a plasmid, e.g., the heterologous nucleic acids are expressed in the host cells by a plasmid (e.g., an expression vector). In some embodiments, heterologous nucleic acids are introduced into the host cells described herein using the method of insertion described in International Patent application Publication No. WO 2014/057109. In certain embodiments, additional modifications can be introduced (e.g., using recombinant techniques) into the host cells described herein. For example, host cell nucleic acids (e.g., genes) that encode proteins that form part of a possibly competing or interfering glycosylation pathway (e.g., compete or interfere with one or more heterologous genes involved in glycosylation that are recombinantly introduced into the host cell) can be deleted or modified in the host cell background (genome) in a manner that makes them inactive/dysfunctional (i.e., the host cell nucleic acids that are deleted/modified do not encode a functional protein or do not encode a protein whatsoever). In certain embodiments, when nucleic acids are deleted from the genome of the host cells provided herein, they are replaced by a desirable sequence, e.g., a sequence that is useful for glycoprotein production. Exemplary genes that can be deleted in host cells (and, in some cases, replaced with other desired nucleic acid sequences) include genes of host cells involved in glycolipid biosynthesis, such as waaL (see, e.g., Feldman et al., 2005, PNAS USA 102:3016-3021), the lipid A core biosynthesis cluster (waa), galactose cluster (gal), arabinose cluster (ara), colanic acid cluster (wca), capsular polysaccharide cluster, metabolic enzymes involved in nucleotide activated sugar biosynthesis, enterobacterial common antigen cluster (wec), and prophage O antigen modification clusters like the gtrABS cluster The host cells described herein can produce the N-glycosylated carrier proteins described herein. In some embodiments, the N-glycosylated carrier proteins produced by the host cells described herein are antigens, e.g., viral or bacterial antigens that can be used in vaccines. In some embodiments, the N-glycosylated carrier proteins produced by the host cells described herein can be any protein containing a glycosylation consensus sequence described herein, wherein said proteins are modified by the host cells described herein so as to possess one or more beneficial characteristics, e.g., the protein is N-glycosylated. Certain of the Examples below describe application of methods described herein in Gram- negative E. coli host cells; however, any host cells known to those of skill in the art could be used as to produce N-glycosylated carrier proteins, including archea, prokaryotic host cells other than E. coli, and eukaryotic host cells. Exemplary prokaryotic host cells that can be used in accordance with the methods described herein comprise, without limitation, Escherichia species, Shigella species, Klebsiella species, Xhantomonas species, Salmonella species, Yersinia species, Lactococcus species, Lactobacillus species, Pseudomonas species, Corynebacterium species, Streptomyces species, Streptococcus species, Staphylococcus species, Bacillus species, and Clostridium species. In certain embodiments, the host cells described herein comprise a genome into which one or more DNA sequences has been introduced, wherein the DNA sequences encode a protein or comprise an operon/gene cluster involved in the N-glycosylation of proteins. For example, in some embodiments, a host cell described herein comprises a genome into which one or more of the following has been inserted: DNA encoding an engineered Pg1B OST, DNA encoding a glycosyltransferase, DNA encoding a protein containing at least one glycosylation sequence, DNA comprising an rfb gene cluster, DNA comprising a capsular polysaccharide gene cluster, and/or DNA encoding an epimerase. The host cells can include engineered Pg1B OSTs or C. coli Pg1B OSTs provided herein or nucleic acids encoding the engineered Pg1B OSTs or C. coli Pg1B OSTs provided herein, whereby the engineered Pg1B OSTs can be from any organism having N-OSTs, including a prokaryotic organism. In some embodiments, the Pg1B OST protein or Pg1B OST encoding nucleic acid is from the genus Campylobacter (e.g., the pglB gene from C. jejuni). The host cells described herein can comprise a glycosyltransferase known in the art or a nucleic acid sequence encoding a glycosyltransferases known in the art. In some embodiments, the glycosyltransferase is a glycosyltransferase described in International Patent Application Publication No. WO 2011/138361, the disclosure of which is incorporated by reference herein in its entirety. In some embodiments, the glycosyltransferase is from a Gram-positive bacterium, e.g., the glycosyltransferase is from S. pneumoniae, for example from S. pneumoniae serotype 1, 2, 3, 4, 5, 6A, 6B, 6C, 7F, 8, 9A, 9L, 9N, 9V, 10A, 11A, 12F, 14, 15A, 15B, 16F, 18C, 19A, 19F, 22F, 23F, 33F, 35B (preferrably from serotype 8), or from Streptococcus pyogenes (group B streptococcus capsular serotype polysaccharides from serotype Ia, Ib, II, III, IV, V, VI, VII, or VIII). In some embodiments, the glycosyltransferase is capsular polysaccharide 5 from S. aureus. In some embodiments, the glycosyltransferase is capsular polysaccharide 8 from S. aureus. In some embodiments, the glycosyltransferase is from a Gram-negative bacterium, e.g., E. coli or Shigella flexneri or Shigella sonnei. The host cells described herein can comprise or produce a protein containing at least one glycosylation consensus site or comprise a nucleic acid sequence encoding a protein containing at least one glycosylation consensus sequence known in the art. The proteins produced by the host cells described herein comprise at least one N-glycosylation consensus sequence, e.g., either the consensus sequence (i) Asn-Z-Ser(Thr), wherein Z is are independently selected from any amino acid except Pro; or (ii) D/E-Z ₁ -N-Z ₂ -S/T, wherein Z1 and Z2 are independently selected from any amino acid except Pro. Accordingly, the host cell can comprise DNA sequences encoding an N-glycosylation consensus sequence. The host cell can include any protein known in the art, including these described herein. In some embodiments, the protein is a carrier protein such as an Exotoxin A of P. aeruginosa (EPA), including EPA that has been modified to comprise at least one N-glycosylation consensus sequence. In some embodiments, the protein is the carrier protein is cholera toxin B. In some embodiments, the carrier protein is AcrA. In some embodiments, the carrier protein is HlA. In some embodiments, the carrier protein is ClfA. In some embodiments, the carrier protein is CRM197. Bioconjugates The bioconjugates described herein are conjugates between a protein (e.g., any carrier protein described herein) and an oligosaccharide or a polysaccharide (e.g., any oligosaccharide or polysaccharide described herein) prepared in a host cell, wherein host cell machinery links the oligosaccharide or polysaccharide to the protein (e.g., N-links). In some embodiments, the oligosaccharide or polysaccharide is an antigen (e.g., any antigen described herein). Glycoconjugates can include bioconjugates, as well as sugar antigen (e.g., oligo- and polysaccharides)-protein conjugates prepared by other means, e.g., by chemical linkage of the protein and sugar antigen. The engineered Pg1B OSTs or C. coli Pg1B OSTs described herein can be introduced into a cell (e.g. a Gram-negative bacterial cell) to produce host cells that produce bioconjugates comprising an N-glycosylated carrier protein. In some embodiments, provided herein are bioconjugates including a carrier protein N-glycosylated with an antigen (e.g., an oligosaccharide or a polysaccharide) described herein. In some embodiments, the carrier protein is EPA. The bioconjugates described herein can, for example and without limitation, comprise any carrier protein described herein. The bioconjugates described herein can, for example and without limitation, comprise any oligosaccharide or polysaccharide described herein. In an embodiment, the heterologous glycosylated carrier protein is Streptococcus pneumoniae serotype 1 – EPA, Streptococcus pneumoniae serotype 12F- EPA, Streptococcus pneumoniae serotype 8-EPA, S. pneumoniae serotype 19A-EPA, S. pneumoniae serotype 22F-EPA, S. pneumoniae serotype 23A-EPA, or S. pneumoniae serotype 35B-EPA. In an embodiment, the heterologous glycosylated carrier protein is a S. pneumoniae capsular saccharide or Group B streptococcus capsular saccharide attached to a carrier protein, for example EPA, CRM197, DT or TT. In an embodiment, the heterologous glycosylated carrier protein is S. aureus capsular polysaccharide type 5 conjugated to EPA, CRM197, DT, TT or a staphylococcal protein such as ClfA or Hla , or a S. aureus capsular polysaccharide type 8 conjugated to EPA, CRM197, DT, TT or a staphylococcal protein such as ClfA or Hla or S. sonnei-EPA. In some embodiments, provided herein is a bioconjugate including EPA and one or more different oligosaccharides or polysaccharides described herein. In some embodiments, provided herein is a bioconjugate including carrier protein conjugated to one or more of E.coli O1, O2, O4, O6, O7, O8, O11, O15, O16, O17, O18, O20, O22, O25, O73, O75, and/or O83. In some embodiments, the carrier protein is EPA. In some embodiments, provided herein is a bioconjugate including a carrier protein conjugated to one or more different P. aeruginosa polysaccharides. In some embodiments, the carrier protein is EPA. In some embodiments, provided herein is a bioconjugate comprising a carrier protein conjugated to one or more different K. pneumonia polysaccharides. In a specific embodiment, the carrier protein is EPA. Methods for Producing a Bioconjugate In some embodiments, the engineered Pg1B OSTs provided herein can be used to produce a bioconjugate provided herein, such as a glycoconjugate. In some embodiments, the engineered Pg1B OSTs provided herein can be used to produce conjugate vaccines, i.e. vaccines that contain an oligosaccharide or polysaccharide and a protein antigen of the pathogen that the vaccine is designed against. In another aspect, provided herein is a method of producing a bioconjugate including culturing a host cell provided herein, in a cell culture medium. In some embodiments, the host cell comprises a nucleic acid encoding an engineered Pg1B OST provided herein. In some embodiments, the host cell comprises a nucleic acid encoding a carrier protein described herein. In some embodiments, the carrier protein has one or more N- glycosylation consensus sequence. In some embodiments, the host cell comprises a nucleic acid encoding a glycosyltransferase. In some embodiments, the bioconjugate is an N-glycosylated carrier protein. The N- glycosylated carrier protein can comprise an oligosaccharide or polysaccharide component including any oligosaccharide or polysaccharide described herein. The N-glycosylated carrier protein can comprise any carrier protein described herein. In some embodiments, the bioconjugate is a natural C. jejuni N-glycosylated polypeptide (including a C. jejuni oligosaccharide or polysaccharide component and a C. jejuni carrier protein). In some embodiments, the bioconjugate is a heterologous C. jejuni glycosylated polypeptide (including a polysaccharide component and/or a carrier protein that is not from C. jejuni). In some embodiments, the glycosylated polypeptide does not have an N-acetyl sugar at its reducing end. In some embodiments, the glycosylated polypeptide has a glucose or galactose at its reducing end. In some embodiments, the methods further comprise purifying the bioconjugate from the host cell culture. Methods for purifying bioconjugates, such as N-glycosylated carrier proteins, from host cell cultures are known in the art. See, e.g., Jan-Christer Janson, Protein Purification: Principles, High Resolution Methods, and Applications. Wiley; 3 edition (March 22, 2011). Analytical Methods Various methods can be used to analyze the structural compositions and sugar chain lengths of the bioconjugates or N-glycosylated carrier proteins described herein. In one embodiment, hydrazinolysis can be used to analyze glycans. First, polysaccharides are released from their protein carriers by incubation with hydrazine according to the manufacturer’s instructions (Ludger Liberate Hydrazinolysis Glycan Release Kit, Oxfordshire, UK). The nucleophile hydrazine attacks the glycosidic bond between the polysaccharide and the carrier protein and allows release of the attached glycans. N-acetyl groups are lost during this treatment and have to be reconstituted by re-N-acetylation. The free glycans are purified on carbon columns and subsequently labeled at the reducing end with the fluorophor 2-amino benzamide (Bigge JC, Patel TP, Bruce JA, Goulding PN, Charles SM, Parekh RB. Nonselective and efficient fluorescent labeling of glycans using 2-amino benzamide and anthranilic acid. Anal Biochem.1995 Sep 20;230(2):229-38). The labeled polysaccharides are separated on a GlycoSep-N column (GL Sciences) according to the HPLC protocol of Royle et al. (Royle L, Mattu TS, Hart E, Langridge JI, Merry AH, Murphy N, Harvey DJ, Dwek RA, Rudd PM. An analytical and structural database provides a strategy for sequencing O-glycans from microgram quantities of glycoproteins. Anal Biochem.2002 May 1;304(1):70-90). The resulting fluorescence chromatogram indicates the polysaccharide length and number of repeating units. Structural information can be gathered by collecting individual peaks and subsequently performing MS/MS analysis. Thereby the monosaccharide composition and sequence of the repeating unit could be confirmed and additionally in homogeneity of the polysaccharide composition could be identified. Specific peaks of low molecular weight can be analyzed by MALDI-MS/MS and the result is used to confirm the glycan sequence. Each peak corresponds to a polymer consisting of a certain number of repeat units and fragments thereof. The chromatogram thus allows to measure the polymer length distribution. The elution time is an indication for polymer length, fluorescence intensity correlates with molar abundance for the respective polymer. In another embodiment, SDS-PAGE or capillary gel electrophoresis can be used to assess glycans and glycoconjugates. Polymer length for the O antigen glycans which are synthesized here is defined by the number of repeat units that are linearly assembled. This means that the typical ladder like pattern is a consequence of different repeat unit numbers that compose the glycan. Thus, two bands next to each other in SDS PAGE or other techniques that separate by size differ by only a single repeat unit. These discrete differences are exploited when analyzing glycoproteins for glycan size: The unglycosylated carrier protein and the glycoconjugate with different polymer chain lengths separate according to their electrophoretic mobilities. The first detectable repeating unit number (n1) and the average repeating unit number (naverage) present on a glycoconjugate are measured. These parameters can be used to demonstrate batch to batch consistency or polysaccharide stability. In another embodiment, high mass MS and size exclusion HPLC could be applied to measure the size of the complete glycoconjugates. In another embodiment, an anthrone-sulfuric acid assay can be used to measure polysaccharide yields (Leyva A, Quintana A, Sánchez M, Rodríguez EN, Cremata J, Sánchez JC. Rapid and sensitive anthrone-sulfuric acid assay in microplate format to quantify carbohydrate in biopharmaceutical products: method development and validation. Biologicals.2008 Mar;36(2):134-41. Epub 2007 Nov 26). Change in glycosylation site usage To show that the site usage in a specific protein is changed glycosylation site usage can be quantified. Methods to do so are listed below. Glycopeptide LC-MS/MS: glycoconjugates are digested with protease(s), and the peptides are separated by a suitable chromatographic method (C18, Hydrophilic interaction HPLC HILIC, GlycoSepN columns, SE HPLC, AE HPLC), and the different peptides are identified using MS/MS. This method can be used with or without previous sugar chain shortening by chemical (smith degradation) or enzymatic methods. Quantification of glycopeptide peaks using UV detection at 215 to 280 nm allow relative determination of glycosylation site usage. Size exclusion HPLC: Higher glycosylation site usage is reflected by an earlier elution time from a SE HPLC column. See also (a). Homogeneity Glycoconjugate homogeneity (the homogeneity of the attached sugar residues) can be assessed using methods that measure glycan length and hydrodynamic radius. Benefits The engineered Pg1B OSTs provided herein and methods provided herein of using the engineered Pg1B OST provided herein are of particular commercial importance and relevance, as they allow for rapid, high-yield, large-scale and low-cost fermentation of highly homogeneous preparations of glycosylated proteins (including for example glycoconjugate preparation or conjugate vaccine preparations). The engineered Pg1B OSTs provided herein enable an economically viable production of commercially and therapeutically valuable glycosylated proteins, such as conjugate vaccines. In addition, the engineered Pg1B OSTs of invention provide more efficient N-glycosylation of proteins, particularly in cases where the glycan is not naturally transferred by wild type Pg1B. For example where the oligosaccharide to be transferred to the N residue of the protein does not have a GlcNAc residue at the reducing terminus, for example where the reducing terminus of the oligosaccharide is a glucose residue. The reproducibility and robustness of biotechnological bioconjugate production methods using the engineered Pg1B OSTs provided herein, is expected to contribute to a reduction of production costs. The homogeneity of especially biotherapeutic conjugate vaccines is generally believed to affect the clinical safety of drug products. Abbreviations and Definitions For the purposes of the descriptions herein, the abbreviations used for the genetically encoded amino acids are conventional and are as follows in Table 1: Table 1 AMINO ACID THREE-LETTER ONE-LETTER ALANINE ALA A ARGININE ARG R ASPARAGINE ASN N AMINO ACID THREE-LETTER ONE-LETTER ASPARTATE ASP D CYSTEINE CYS C GLUTAMATE GLU E GLUTAMINE GLN Q GLYCINE GLY G HISTIDINE HIS H ISOLEUCINE ILE I LEUCINE LEU L LYSINE LYS K METHIONINE MET M PHENYLALANINE PHE F PROLINE PRO P SERINE SER S THREONINE THR T TRYPTOPHAN TRP W TYROSINE TYR Y VALINE VAL V When the three-letter abbreviations are used, unless specifically preceded by an “L” or a “D” or clear from the context in which the abbreviation is used, the amino acid may be in either the L- or D-configuration about ^-carbon (C ^). For example, whereas “Ala” designates alanine without specifying the configuration about the ^ carbon, “D-Ala” and “L-Ala” designate D-alanine and L-alanine, respectively. When the one-letter abbreviations are used, upper case letters designate amino acids in the L-configuration about the α-carbon and lower case letters designate amino acids in the D-configuration about the α-carbon. For example, “A” designates L-alanine and “a” designates D-alanine. When peptide sequences are presented as a string of one-letter or three-letter abbreviations (or mixtures thereof), the sequences are presented in the N→C direction in accordance with convention. The technical and scientific terms used in the descriptions herein will have the meanings commonly understood by one of ordinary skill in the art, unless specifically defined otherwise. Accordingly, the following terms are intended to have the following meanings. All U.S patents and published U.S. patent applications, including all sequences disclosed within such patents and patent applications, referred to herein are expressly incorporated by reference. “Acidic amino acid or residue” refers to a hydrophilic amino acid or residue having a side chain exhibiting a pK value of less than about 6 when the amino acid is included in a peptide or polypeptide. Acidic amino acids typically have negatively charged side chains at physiological pH due to loss of a hydrogen ion. Genetically, encoded acidic amino acids include L-Glu (E) and L-Asp (D). “Amino acid” or “residue” as used in context of the polypeptides disclosed herein refers to the specific monomer at a sequence position (e.g.., P5 indicates that the “amino acid” or “residue” at position 5 of SEQ ID NO: 2 is a proline.) “Amino acid difference” or “residue difference” refers to a change in the residue at a specified position of a polypeptide sequence when compared to a reference sequence. The polypeptide sequence position at which a particular amino acid or amino acid change (“residue difference”) is present is sometimes described herein as “Xn”, or “position n”, where n refers to the residue position with respect to the reference sequence. For example, a residue difference at position X8, where the reference sequence has a serine, refers to a change of the residue at position X8 to any residue other than serine. As disclosed herein, an enzyme can include one or more residue differences relative to a reference sequence, where multiple residue differences typically are indicated by a list of the specified positions where changes are made relative to the reference sequence (e.g., “one or more residue differences as compared to SEQ ID NO: 1 at the following residue positions: X27, X30, X35, X37, X57, X75, X103, X185, X207, X208, X271, X286, or X296.”). A specific substitution mutation, which is a replacement of the specific residue in a reference sequence with a different specified residue may be denoted by the conventional notation “X(number)X’, where X is the single letter identifier of the residue in the reference sequence, “number” is the residue position in the reference sequence, and X’is the single letter identifier of the residue substitution in the engineered sequence. “Aliphatic amino acid or residue” refers to a hydrophobic amino acid or residue having an aliphatic hydrocarbon side chain. Genetically encoded aliphatic amino acids include L-Ala (A), L-Val (V), L-Leu (L) and L-Ile (I). “Aromatic amino acid or residue” refers to a hydrophilic or hydrophobic amino acid or residue having a side chain that includes at least one aromatic or heteroaromatic ring. Genetically encoded aromatic amino acids include L-Phe (F), L-Tyr (Y) and L-Trp (W). Although owing to the pKa of its heteroaromatic nitrogen atom L-His (H) it is sometimes classified as a basic residue, or as an aromatic residue as its side chain includes a heteroaromatic ring, herein histidine is classified as a hydrophilic residue or as a “constrained residue” (see below). “Basic amino acid or residue” refers to a hydrophilic amino acid or residue having a side chain exhibiting a pKa value of greater than about 6 when the amino acid is included in a peptide or polypeptide. Basic amino acids typically have positively charged side chains at physiological pH due to association with hydronium ion. Genetically encoded basic amino acids include L-Arg (R) and L-Lys (K). “Codon-optimized” refers to changes in the codons of the polynucleotide encoding a protein to those preferentially used in a particular organism such that the encoded protein is efficiently expressed in the organism of interest. Although the genetic code is degenerate in that most amino acids are represented by several codons, called “synonyms” or “synonymous” codons, it is well known that codon usage by particular organisms is nonrandom and biased towards particular codon triplets. This codon usage bias may be higher in reference to a given gene, genes of common function or ancestral origin, highly expressed proteins versus low copy number proteins, and the aggregate protein coding regions of an organism's genome. In some embodiments, the polynucleotides encoding the Pg1B oligosaccharyltransferase enzymes may be codon-optimized for optimal production from the host organism selected for expression. “Comparison window” refers to a conceptual segment of at least about 20 contiguous nucleotide positions or amino acids residues wherein a sequence may be compared to a reference sequence of at least 20 contiguous nucleotides or amino acids and wherein the portion of the sequence in the comparison window may comprise additions or deletions (i.e., gaps) of 20 percent or less as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences. The comparison window can be longer than 20 contiguous residues, and includes, optionally 30, 40, 50, 100, or longer windows. “Conservative” amino acid substitutions or mutations refer to the interchangeability of residues having similar side chains, and thus typically involves substitution of the amino acid in the polypeptide with amino acids within the same or similar defined class of amino acids. However, as used herein, in some embodiments, conservative mutations do not include substitutions from a hydrophilic to hydrophilic, hydrophobic to hydrophobic, hydroxyl-containing to hydroxyl-containing, or small to small residue, if the conservative mutation can instead be a substitution from an aliphatic to an aliphatic, non-polar to non- polar, polar to polar, acidic to acidic, basic to basic, aromatic to aromatic, or constrained to constrained residue. Further, as used herein, A, V, L, or I can be conservatively mutated to either another aliphatic residue or to another non-polar residue. Table 2 below shows exemplary conservative substitutions. Table 2 “Constrained amino acid or residue” refers to an amino acid or residue that has a constrained geometry. Herein, constrained residues include L-Pro (P) and L-His (H). Histidine has a constrained geometry because it has a relatively small imidazole ring. Proline has a constrained geometry, because it also has a five-membered ring. “Control sequence” is defined herein to include all components, which are necessary or advantageous for the expression of a polynucleotide and/or polypeptide of the present disclosure. Each control sequence may be native or foreign to the polynucleotide of interest. Such control sequences include, but are not limited to, a leader, polyadenylation sequence, propeptide sequence, promoter, signal peptide sequence, and transcription terminator. “Corresponding to”, “reference to” or “relative to” when used in the context of the numbering of a given amino acid or polynucleotide sequence refers to the numbering of the residues of a specified reference sequence when the given amino acid or polynucleotide sequence is compared to the reference sequence. In other words, the residue number or residue position of a given polymer is designated with respect to the reference sequence rather than by the actual numerical position of the residue within the given amino acid or polynucleotide sequence of the non-reference sequence. For example, a given amino acid sequence, such as that of an engineered Pg1B oligosaccharyltransferase, can be aligned to a reference sequence by introducing gaps to optimize residue matches between the two sequences. In these cases, although the gaps are present, the numbering of the residue in the given amino acid or polynucleotide sequence is made with respect to the reference sequence to which it has been aligned. “Cysteine” or L-Cys (C) is unusual in that it can form disulfide bridges with other L-Cys (C) amino acids or other sulfanyl- or sulfhydryl-containing amino acids. The “cysteine- like residues” include cysteine and other amino acids that contain sulfhydryl moieties that are available for formation of disulfide bridges. The ability of L-Cys (C) (and other amino acids with -SH containing side chains) to exist in a peptide in either the reduced free -SH or oxidized disulfide-bridged form affects whether L-Cys (C) contributes net hydrophobic or hydrophilic character to a peptide. While L-Cys (C) exhibits a hydrophobicity of 0.29 according to the normalized consensus scale of Eisenberg (Eisenberg et al., 1984, supra), it is to be understood that for purposes of the present disclosure L-Cys (C) is categorized into its own unique group. “Deletion” refers to modification of the polypeptide by removal of one or more amino acids from the reference polypeptide. Deletions can comprise removal of 1 or more amino acids, 2 or more amino acids, 5 or more amino acids, 10 or more amino acids, 15 or more amino acids, or 20 or more amino acids, up to 10% of the total number of amino acids, up to 20% of the total number of amino acids, or up to 30% of the total number of amino acids making up the polypeptide while retaining enzymatic activity and/or retaining the improved properties of an engineered Pg1B oligosaccharyltransferase enzyme. Deletions can be directed to the internal portions and/or terminal portions of the polypeptide. In various embodiments, the deletion can comprise a continuous segment or can be discontinuous. “Derived from” as used herein in the context of engineered enzymes identifies the originating enzyme, and/or the gene encoding such enzyme, upon which the engineering was based. For example, the engineered oligosaccharyltransferase enzyme of SEQ ID NO: 5 was obtained by mutating the Pg1B oligosaccharyltransferase of SEQ ID NO: 2. Thus, this engineered Pg1B oligosaccharyltransferase enzyme of SEQ ID NO: 5 is “derived from” the polypeptide of SEQ ID NO: 2 An “engineered Pg1B oligosaccharyltransferase”, as used herein, refers to a Pg1B oligosaccharyltransferase-type protein which has been systematically modified, through the insertion of new amino acids into its reference sequence, the deletion of amino acids present in its reference sequence, or the mutation of amino acids in its reference sequence into alternate amino acids, either through a process of random mutagenesis followed by selection of mutants having a particular property or through the intentional introduction of particular amino acid changes into the protein sequence. “Fragment”, as used herein refers to a polypeptide that has an amino-terminal and/or carboxy-terminal deletion, but where the remaining amino acid sequence is identical to the corresponding positions in the sequence. Fragments can be at least 14 amino acids long, at least 20 amino acids long, at least 50 amino acids long or longer, and up to 70%, 80%, 90%, 95%, 98%, and 99%, or more, of the full-length Pg1B oligosaccharyltransferase polypeptide, for example, the polypeptide of SEQ ID NO: 5. A "functional fragment" or a "biologically active fragment", used interchangeably, herein refers to a polypeptide that has an amino-terminal and/or carboxy-terminal deletion(s) and/or internal deletions, but where the remaining amino acid sequence is identical to the corresponding positions in the sequence to which it is being compared and that retains substantially all of the activity of the full-length polypeptide. A functional fragment contains at least 100, 200, 300, 400 or 500 contiguous amino acids “Heterologous” polynucleotide refers to any polynucleotide that is introduced into a host cell by laboratory techniques, and includes polynucleotides that are removed from a host cell, subjected to laboratory manipulation, and then reintroduced into a host cell. “Hybridization stringency” relates to hybridization conditions, such as washing conditions, in the hybridization of nucleic acids. Generally, hybridization reactions are performed under conditions of lower stringency, followed by washes of varying but higher stringency. The term “moderately stringent hybridization” refers to conditions that permit target-DNA to bind a complementary nucleic acid that has about 60% identity, preferably, about 75% identity, about 85% identity to the target DNA, or with greater than about 90% identity to target-polynucleotide. Exemplary moderately stringent conditions are conditions equivalent to hybridization in 50% formamide, 5× Denhart's solution, 5× saline-sodium phosphate-EDTA (SSPE), 0.2% sodium dodecyl sulfate (SDS) at 42°C., followed by washing in 0.2×SSPE, 0.2% SDS, at 42°C. “High stringency hybridization” refers generally to conditions that are about 10°C or less from the thermal melting temperature Tm as determined under the solution condition for a defined polynucleotide sequence. In some embodiments, a high stringency condition refers to conditions that permit hybridization of only those nucleic acid sequences that form stable hybrids in 0.018M NaCl at 65°C. (i.e., if a hybrid is not stable in 0.018M NaCl at 65°C, it will not be stable under high stringency conditions, as contemplated herein). High stringency conditions can be provided, for example, by hybridization in conditions equivalent to 50% formamide, 5× Denhart's solution, 5×SSPE, 0.2% SDS at 42°C, followed by washing in 0.1×SSPE, and 0.1% SDS at 65°C. Another high stringency condition is hybridizing in conditions equivalent to hybridizing in 5X SSC containing 0.1% (w:v) SDS at 65°C and washing in 0.1x SSC containing 0.1% SDS at 65°C. Other high stringency hybridization conditions, as well as moderately stringent conditions, are described in the references cited above “Hydrophilic amino acid or residue” refers to an amino acid or residue having a side chain exhibiting a hydrophobicity of less than zero according to the normalized consensus hydrophobicity scale of Eisenberg et al., 1984, J. Mol. Biol.179:125-142. Genetically encoded hydrophilic amino acids include L-Thr (T), L-Ser (S), L-His (H), L-Glu (E), L-Asn (N), L-Gln (Q), L-Asp (D), L-Lys (K) and L-Arg (R).“Hydrophobic amino acid or residue” refers to an amino acid or residue having a side chain exhibiting a hydrophobicity of greater than zero according to the normalized consensus hydrophobicity scale of Eisenberg et al., 1984, J. Mol. Biol.179:125-142. Genetically, encoded hydrophobic amino acids include L-Pro (P), L-Ile (I), L-Phe (F), L-Val (V), L-Leu (L), L-Trp (W), L-Met (M), L-Ala (A) and L-Tyr (Y). “Hydroxyl-containing amino acid or residue” refers to an amino acid containing a hydroxyl (-OH) moiety. Genetically-encoded hydroxyl-containing amino acids include L-Ser (S) L-Thr (T) and L-Tyr (Y). “Improved enzyme property” refers to any enzyme property made better or more desirable for a particular purpose as compared to that property found in a reference enzyme. For the engineered Pg1B oligosaccharyltransferase polypeptides described herein, the comparison is generally made to a reference Pg1B oligosaccharyltransferase enzyme which does not contain the particular mutation which improves enzyme efficiency, although in some embodiments, the reference Pg1B oligosaccharyltransferase can be another improved engineered Pg1B oligosaccharyltransferase. Enzyme properties for which improvement can be made include, but are not limited to, enzymatic activity (which can be expressed in terms of yield of N-glycosylated protein), thermal stability, solvent stability, pH activity profile, coenzyme requirements, refractoriness to inhibitors (e.g., product inhibition), stereospecificity, and suppression of acid side-product production. “Insertion” refers to modification of the polypeptide by addition of one or more amino acids to the reference polypeptide. In some embodiments, the improved engineered Pg1B oligosaccharyltransferase enzymes comprise insertions of one or more amino acids to the naturally occurring Pg1B oligosaccharyltransferase polypeptide as well as insertions of one or more amino acids to other improved Pg1B oligosaccharyltransferase polypeptides. Insertions can be in the internal portions of the polypeptide, or to the carboxy or amino terminus Insertions as used herein include fusion proteins as is known in the art The insertion can be a contiguous segment of amino acids or separated by one or more of the amino acids in the naturally occurring polypeptide. “Isolated polypeptide” refers to a polypeptide which is substantially separated from other contaminants that naturally accompany it, e.g., protein, lipids, and polynucleotides. The term embraces polypeptides which have been removed or purified from their naturally- occurring environment or expression system (e.g., host cell or in vitro synthesis). The improved Pg1B oligosaccharyltransferase enzymes may be present within a cell, present in the cellular medium, or prepared in various forms, such as lysates or isolated preparations. As such, in some embodiments, the improved Pg1B oligosaccharyltransferase enzyme can be an isolated polypeptide. “Non-conservative substitution” refers to substitution or mutation of an amino acid in the polypeptide with an amino acid with significantly differing side chain properties. Non- conservative substitutions may use amino acids between, rather than within, the defined groups listed above. In one embodiment, a non-conservative mutation affects: (a) the structure of the peptide backbone in the area of the substitution (e.g., proline for glycine); (b) the charge or hydrophobicity; or (c) the bulk of the side chain. “Non-polar amino acid” or “Non-polar residue” refers to a hydrophobic amino acid or residue having a side chain that is uncharged at physiological pH and which has bonds in which the pair of electrons shared in common by two atoms is generally held equally by each of the two atoms (i.e., the side chain is not polar). Genetically encoded non-polar amino acids include L-Gly (G), L-Leu (L), L-Val (V), L-Ile (I), L-Met (M) and L-Ala (A). “Percentage of sequence identity,” “percent identity,” and “percent identical” are used herein to refer to comparisons between polynucleotide sequences or polypeptide sequences, and are determined by comparing two optimally aligned sequences over a comparison window, wherein the portion of the polynucleotide or polypeptide sequence in the comparison window may comprise additions or deletions (i.e., gaps) as compared to the reference sequence for optimal alignment of the two sequences. The percentage is calculated by determining the number of positions at which either the identical nucleic acid base or amino acid residue occurs in both sequences or a nucleic acid base or amino acid residue is aligned with a gap to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity. Determination of optimal alignment and percent sequence identity is performed using the BLAST and BLAST 2.0 algorithms (see, e.g., Altschul, et al., 1990, J. Mol. Biol.215: 403-410 and Altschul, et al., 1977, Nucleic Acids Res.3389-3402). Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information website. Briefly, the BLAST analyses involve first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as, the neighborhood word score threshold (Altschul, et al, supra). These initial neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them. The word hits are then extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always >0) and N (penalty score for mismatching residues; always<0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment. The BLASTN program (for nucleotide sequences) uses as defaults a word length (W) of 11, an expectation (E) of 10, M=5, N=-4, and a comparison of both strands. For amino acid sequences, the BLASTP program uses as defaults a wordlength (W) of 3, an expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff and Henikoff, 1989, Proc Natl Acad Sci USA 89:10915). Numerous other algorithms are available that function similarly to BLAST in providing percent identity for two sequences. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith and Waterman, 1981, Adv. Appl. Math.2:482, by the homology alignment algorithm of Needleman and Wunsch, 1970, J. Mol. Biol.48:443, by the search for similarity method of Pearson and Lipman, 1988, Proc. Natl. Acad. Sci. USA 85:2444, by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the GCG Wisconsin Software Package), or by visual inspection (see generally, Current Protocols in Molecular Biology, F. M. Ausubel, et al., eds., Current Protocols, a joint venture between Greene Publishing Associates, Inc. and John Wiley & Sons, Inc., (1995 Supplement) (Ausubel)). Additionally, determination of sequence alignment and percent sequence identity can employ the BESTFIT or GAP programs in the GCG Wisconsin Software package (Accelrys, Madison WI), using default parameters provided. The ClustalW program is also suitable for determining identity. “Polar amino acid or residue” refers to a hydrophilic amino acid or residue having a side chain that is uncharged at physiological pH, but which has at least one bond in which the pair of electrons shared in common by two atoms is held more closely by one of the atoms. Genetically encoded polar amino acids include L-Asn (N), L-Gln (Q), L-Ser (S) and L-Thr (T). “Preferred, optimal, high codon usage bias codons” refers, interchangeably, to codons that are used at higher frequency in the protein coding regions than other codons that code for the same amino acid. The preferred codons may be determined in relation to codon usage in a single gene, a set of genes of common function or origin, highly expressed genes, the codon frequency in the aggregate protein coding regions of the whole organism, codon frequency in the aggregate protein coding regions of related organisms, or combinations thereof. Codons whose frequency increases with the level of gene expression are typically optimal codons for expression. A variety of methods are known for determining the codon frequency (e.g., codon usage, relative synonymous codon usage) and codon preference in specific organisms, including multivariate analysis, for example, using cluster analysis or correspondence analysis, and the effective number of codons used in a gene (see GCG Codon Preference, Genetics Computer Group Wisconsin Package; CodonW, John Peden, University of Nottingham; McInerney, J. O, 1998, Bioinformatics 14:372-73; Stenico, et al., 1994, Nucleic Acids Res.222437-46; Wright, F., 1990, Gene 87:23-29). Codon usage tables are available for a growing list of organisms (see for, example, Wada, et al., 1992, Nucleic Acids Res.20:2111-2118; Nakamura, et al., 2000, Nucl. Acids Res.28:292; Duret, et al., supra; Henaut and Danchin, “Escherichia coli and Salmonella,” 1996, Neidhardt, et al., Eds., ASM Press, Washington D.C., p.2047-2066. The data source for obtaining codon usage may rely on any available nucleotide sequence capable of coding for a protein. These data sets include nucleic acid sequences actually known to encode expressed proteins (e.g.., complete protein coding sequences-CDS), expressed sequence tags (EST), or predicted coding regions of genomic sequences (see for example, Mount, D., Bioinformatics: Sequence and Genome Analysis, Chapter 8, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 2001; Uberbacher, E. C., 1996, Methods Enzymol.266:259-281; Tiwari, et al.., 1997, Comput. Appl. Biosci.13:263-270). “Protein”, “polypeptide,” and “peptide” are used interchangeably herein to denote a polymer of at least two amino acids covalently linked by an amide bond, regardless of length or post-translational modification (e.g., glycosylation, phosphorylation, lipidation, myristilation, ubiquitination, etc.). Included within this definition are D- and L-amino acids, and mixtures of D- and L-amino acids. “Reference sequence” refers to a defined sequence to which another (e.g., altered) sequence is compared. A reference sequence may be a subset of a larger sequence, for example, a segment of a full-length gene or polypeptide sequence. Generally, a reference sequence is at least 20 nucleotide or amino acid residues in length, at least 25 residues in length, at least 50 residues in length, or the full length of the nucleic acid or polypeptide. Because two polynucleotides or polypeptides may each (1) comprise a sequence (i.e., a portion of the complete sequence) that is similar between the two sequences, and (2) may further comprise a sequence that is divergent between the two sequences, sequence comparisons between two (or more) polynucleotides or polypeptide are typically performed by comparing sequences of the two polynucleotides over a comparison window to identify and compare local regions of sequence similarity. The term, “reference sequence”, is not intended to be limited to wild-type sequences, and can include engineered or altered sequences. For example, in some embodiments, a “reference sequence” can be a previously engineered or altered amino acid sequence. For instance, a “reference sequence based on SEQ ID NO: 2 having a glycine residue at position X12” refers to a reference sequence corresponding to SEQ ID NO: 2 with a glycine residue at X12 (the un-altered version of SEQ ID NO: 2 has an aspartate at X12) “Small amino acid” or “small residue” refers to an amino acid or residue having a side chain that is composed of a total of three or fewer carbon and/or heteroatoms (excluding the ^-carbon and hydrogens). The small amino acids or residues may be further categorized as aliphatic, non-polar, polar or acidic small amino acids or residues, in accordance with the above definitions. Genetically-encoded small amino acids include L-Ala (A), L-Val (V), L-Cys (C), L-Asn (N), L-Ser (S), L-Thr (T) and L-Asp (D). “Substantial identity” refers to a polynucleotide or polypeptide sequence that has at least 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or more percent sequence identity, as compared to a reference sequence over a comparison window of at least 20 residue positions, frequently over a window of at least 30-50 residues, wherein the percentage of sequence identity is calculated by comparing the reference sequence to a sequence that includes deletions or additions which total 20 percent or less of the reference sequence over the window of comparison. In specific embodiments applied to polypeptides, the term “substantial identity” means that two polypeptide sequences, when optimally aligned, such as by the programs GAP or BESTFIT using default gap weights, share at least 80 percent sequence identity, preferably at least 89 percent sequence identity, at least 95 percent sequence identity or more (e.g., 99 percent sequence identity). Preferably, residue positions which are not identical differ by conservative amino acid substitutions. “Substantially pure polypeptide” refers to a composition in which the polypeptide species is the predominant species present (i.e., on a molar or weight basis it is more abundant than any other individual macromolecular species in the composition), and is generally a substantially purified composition when the object species comprises at least about 50 percent of the macromolecular species present by mole or % weight. Generally, a substantially pure Pg1B oligosaccharyltransferase composition will comprise about 60 % or more, about 70% or more, about 80% or more, about 90% or more, about 95% or more, about 96% or more, about 97% or more, about 98% or more or about 99% or more of all macromolecular species by mole or % weight present in the composition. In some embodiments, the object species is purified to essential homogeneity (i.e., contaminant species cannot be detected in the composition by conventional detection methods) wherein the composition consists essentially of a single macromolecular species. Solvent species and elemental ion species are not considered to be macromolecular species. In some embodiments, the isolated improved Pg1B oligosaccharyltransferase polypeptide is a substantially pure polypeptide composition. The invention is further disclosed in the following paragraphs: 1. A Pg1B oligosaccharyltransferase (OST) polypeptide comprising an amino acid sequence that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence set out in SEQ ID NO:1 or 2 or 3 or a functional fragment thereof, wherein the Pg1B oligosaccharyltransferase polypeptide amino acid sequence includes the feature that: at least one residue selected from the group consisting of amino acid X477, X273, X65, X69, X72, X78, X101, X125, X147, X151, X176, X195, X199, X202, X204, X205, X206, X223, X260, X272, X273, X275, X279, X281, X282, X284, X289, X293, X303, X305, X306, X310, X315, X320, X358, X360, X362, X371, X382, X397, X402, X462, X466, X489, X520, X523, X570 and X605 is substituted to a different amino acid to that found at that position in SEQ ID NO:1. 2. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 477 of SEQ ID NO:1 is mutated to a residue that is larger than glycine and aliphatic or polar, for example A or S. 3. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 195 of SEQ ID NO:1 is mutated to a residue that is not a proline for example R, K, H or C, or is basic, for example R or K. 4. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 273 of SEQ ID NO:1 is mutated to a residue that is acidic or basic, for example D, E, K or R. 5. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 65 of SEQ ID NO:1 is mutated to a residue that is aliphatic or polar, for example V or Q. 6. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 69 of SEQ ID NO:1 is mutated to an acidic residue, for example E. 7. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 72 of SEQ ID NO:1 is mutated to a residue that is not a constrained residue, for example D, G or R. 8. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 78 of SEQ ID NO:1 is mutated to a residue that is not an aromatic residue, for example N or R. 9. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 101 of SEQ ID NO:1 is mutated to a residue that is not an aliphatic residue, for example C, G, H, M or W. 10. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 125 of SEQ ID NO:1 is mutated to a residue that is not a basic residue, for example C, L, Q or T. 11. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 147 of SEQ ID NO:1 is mutated to a residue that is not a methionine residue, for example A or I. 12. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 151 of SEQ ID NO:1 is mutated to a residue that is not a tyrosine residue, for example H. 13. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 176 of SEQ ID NO:1 is mutated to a residue that is not an acidic residue, for example G, L, R or W. 14. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 199 of SEQ ID NO:1 is mutated to a valine residue. 15. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 202 of SEQ ID NO:1 is mutated to a residue selected from the group consisting of A, Q and T. 16. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 204 of SEQ ID NO:1 is mutated to a residue that is not an aliphatic residue, for example C, H, Q or T. 17. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 205 of SEQ ID NO:1 is mutated to a residue selected from the group consisting of A, R, T and V. 18. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 206 of SEQ ID NO:1 is mutated to a residue that is basic, acidic or aromatic, for example E, H, R or W. 19. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 223 of SEQ ID NO:1 is mutated to a residue that is acidic, basic or aromatic, for example N, E, H or K. 20. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 260 of SEQ ID NO:1 is mutated to a residue that is selected from the group consisting of C, G, L, P and R. 21. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 272 of SEQ ID NO:1 is mutated to a residue that is selected from the group consisting of E, I, P and W. 22. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 273 of SEQ ID NO:1 is mutated to a residue that is aliphatic or basic, for example L or R. 23. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 275 of SEQ ID NO:1 is mutated to a residue that is basic, constrained or polar, for example K, P or T. 24. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 279 of SEQ ID NO:1 is mutated to a residue that is aliphatic, for example I or L. 25. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 281 of SEQ ID NO:1 is mutated to a residue that is aromatic, basic or polar, for example N, Q, R or W. 26. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 282 of SEQ ID NO:1 is mutated to a residue that is aliphatic, aromatic or basic, for example L, R, V or Y, for example L. 27. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 284 of SEQ ID NO:1 is mutated to a residue that is aromatic or polar, for example S or Y. 28. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 289 of SEQ ID NO:1 is mutated to a residue that is constrained or acidic, for example P or E. 29. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 303 of SEQ ID NO:1 is mutated to a residue that is aromatic, basic or polar, for example, H, M or T. 30. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 306 of SEQ ID NO:1 is mutated to a residue that is aliphatic or polar, for example I, L, S or V, for example L. 31. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 310 of SEQ ID NO:1 is mutated to a residue that is acidic or aliphatic, for example D or I. 32. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 315 of SEQ ID NO:1 is mutated to a residue that is aromatic, for example Y. 33. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 320 of SEQ ID NO:1 is mutated to a residue that is small or aliphatic, for example G or I. 34. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 358 of SEQ ID NO:1 is mutated to a residue that is acidic or polar, for example D or Q. 35. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 360 of SEQ ID NO:1 is mutated to a residue that is nonpolar, for example M. 36. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 362 of SEQ ID NO:1 is mutated to a residue that is nonpolar, for example M. 37. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 371 of SEQ ID NO:1 is mutated to a residue that is basis, aromatic or aliphatic, for example H or I. 38. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 382 of SEQ ID NO:1 is mutated to a residue that is basic or polar, for example C, H or S. 39. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 466 of SEQ ID NO:1 is mutated to a residue that is optionally polar, for example C or T. 40. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 489 of SEQ ID NO:1 is mutated to a residue that is acidic, basic or aliphatic, for example L, R, G or D. 41. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 520 of SEQ ID NO:1 is mutated to a residue that is optionally basic, for example C, H or R. 42. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 523 of SEQ ID NO:1 is mutated to a residue that is optionally basic, for example H, M or R, optionally H or M. 43. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 57O of SEQ ID NO:1 is mutated to a residue that is not a basic residue, for example G, H, P, Q, S, W or A. 44. The Pg1B oligosaccharyltransferase polypeptide or functional fragment thereof of paragraph 1, wherein the residue corresponding to amino acid 605 of SEQ ID NO:1 is mutated to a residue that is aromatic or basic, for example H, R, S or W. 45. The Pg1B oligosaccharyltransferase polypeptide of functional fragment thereof of any one of paragraphs 1-44, wherein the residue corresponding to amino acid 311of SEQ ID NO:1 is mutated to a V residue. 46. The Pg1B oligosaccharyltransferase polypeptide of functional fragment thereof of any one of paragraphs 1-45, wherein the residue corresponding to amino acid 77 of SEQ ID NO:1 is mutated to a R residue. 47. The Pg1B oligosaccharyltransferase polypeptide of functional fragment thereof of any one of paragraphs 1-46, wherein the residue corresponding to amino acid 77 of SEQ ID NO:1 is mutated to a H residue. 48. The Pg1B oligosaccharyltransferase polypeptide of any one of paragraphs 1-47 wherein the Pg1B oligosaccharyltransferase polypeptide is full length, optionally with a length of 712, 713 or 714 amino acids. 49. The Pg1B oligosaccharyltransferase polypeptide of any one of paragraphs 1-48 wherein the Pg1B oligosaccharyltransferase is from C. jejuni. 50. The Pg1B oligosaccharyltransferase polypeptide of any one of paragraphs 1-48 wherein the Pg1B oligosaccharyltransferase is from C. lari. 51. The Pg1B oligosaccharyl transferase polypeptide of any one of paragraphs 1-50 composition wherein the Pg1B oligosaccharyltransferase is engineered. 52. A polynucleotide encoding a mutated Pg1B oligosaccharyltransferase polypeptide as paragraphed in any one of the preceding paragraphs. 53. A composition or host cell (for example a prokaryotic host cell or an E. coli host cell) comprising at least one Pg1B oligosaccharyltransferase of any one of paragraphs 1-51 or the polynucleotide of paragraph 52. 54. The host cell of paragraph 53 which is a prokaryotic host cell, optionally an E. coli host cell. 55. The host cell of paragraph 53 or 54 wherein the polynucleotide encoding Pg1B is integrated into the host cell genome or is expressed from a plasmid. 56. The host cell of paragraph 53, 54 or 55 comprising a further polynucleotide encoding a protein containing at least one glycosylation site comprising the amino acid sequence Asp/Glu-Z ₁ -Asn-Z ₂ -Ser/Thr wherein Z ₁ and Z ₂ may be any natural amino acid except Pro. 57. The host cell of any one of paragraphs 53-56 wherein the protein containing at least one glycosylation site is selected from the group consisting of exotoxin A of P. aeruginosa (EPA), CRM197, diphtheria toxoid, tetanus toxoid, detoxified hemolysin A of S. aureus, clumping factor A, clumping factor B, E. coli FimH, E. coli FimHC, E. coli heat labile enterotoxin, detoxified variants of E. coli heat labile enterotoxin, Cholera toxin B subunit (CTB), cholera toxin, detoxified variants of cholera toxin, E. coli sat protein, the passenger domain of E. coli sat protein, C. jejuni AcrA, and C. jejuni natural glycoproteins. 58. The host cell of paragraph 57 wherein the protein containing at least one glycosylation site is exoprotein A of P. aeruginosa (EPA). 59. The host cell of any one of paragraphs 53-58 wherein the protein containing at least one glycosylation site contains 2, 3 or 4 glycosylation sites. 60. The host cell of any one of paragraphs 53-59 comprising at least one polynucleotide encoding glycosyltransferase(s) required for the assembly of a specific oligosaccharide on an undecaprenyl lipid carrier. 61. The host cell of any one of paragraphs 53-60 wherein the specific oligosaccharide is an antigen, for example a bacterial O antigen or a bacterial capsular saccharide antigen. 62. The host cell of paragraph 61 wherein the specific oligosaccharide comprises an E. coli O-antigen, a Salmonella sp O-antigen, a Pseudomonas sp. O-antigen, a Klebsiella sp. O-antigen, an acinetobacter O antigen, a Chlamydia trachomatis antigen, a Vibrio cholera antigen, a Listeria sp. antigen, a Legionella pneumophila serotypes 1 to 15 antigen, a Bordetella parapertussis antigen, a Burkholderia mallei or pseudomallei antigen, a Francisella tularensis antigen, a Campylobacter sp. antigen; a Clostridium difficile antigen, a Streptococcus agalacticae antigen, a a Neisseria meningitidis antigen, a Candida albicans antigen, a Haemophilus influenza antigen, a Enterococcus faecalis antigen, a Borrelia burgdorferi antigen, a Staphylococcus aureus capsular saccharide antigen, a, Haemophilus influenza antigen, a Leishmania major antigen, a Shigella sp., or a Streptococcus pneumoniae capsular saccharide antigen (e.g.serotypes CP1, CP2, CP3, CP4, CP5, CP6 (A and B), CP7 (A,B, C), CP8, CP9 (A, L,N, V), CP10 (A,B,C,F), CP11 (A, B,C,D,F), CP12(A,B,F), CP13, CP14 CP15(A,B,C,F), CP16(A,F), CP17(A,F), CP18(A,B,C,F), CP19(A,B,C,F), CP20,CP21, CP22(A,F), CP23(A,B,F), CP24(A,B,F), CP25(A,F), CP26, CP27,CP28(A,F), CP29, CP31, CP32(A,F), CP33(A,B,C,D,F), CPS34, CP35(A,B,C,D,F), CP36, CP37, CP38, CP39, CP40, CP41(A,F), CP42, CP43, CP44, CP45, CP46, CP47(A,F), CPS48 ). 63. The host cell of any one of paragraphs 53-62 wherein the specific oligosaccharide comprises a residue that is not GlcNAc at the reducing end of the oligosaccharide. 64. The host cell of any one of paragraphs 53-63 wherein the specific oligosaccharide comprises a glucose residue at the reducing terminus. 65. The host cell of any one of paragraphs 53-64 wherein the specific oligosaccharide comprises a N-acetylfucosamine or N-acetylmannosamine uronic acid residue at the reducing terminus. 66. The host cell of any one of paragraphs 53-65 wherein the specific oligosaccharide comprises a 2-aceamido-2-deoxy-L-altruronic acid or a 2-aceamido-2-deoxy-L-fucose (FucNAc4N) residue at the reducing terminus. 67. A process for preparing a glycosylated protein, comprising the steps of: (a) culturing the host cell of any one of paragraphs 53-66 under conditions suitable for the production of proteins; and (b) isolating the glycosylated protein from the host cell. 68. An in vitro process for preparing a glycosylated protein, comprising the steps of; i) mixing together: a) the Pg1B oligosaccharyltransferase of any one of paragraphs 1-51; b) a protein comprising at least one glycosylation consensus sequence comprising the amino acid sequence Asp/Glu-Z1-Asn-Z2-Ser/Thr wherein Z1 and Z2 may be any natural amino acid except Pro; and c) a saccharide chain on a lipid carrier recognised by the Pg1B; ii) incubating under conditions suitable for the enzymatic activity of Pg1B to transfer the saccharide chain to the at least one glycosylation consensus sequence of the protein to achieve a glycosylated protein; and iii) isolating the glycosylated protein. 69. A glycosylated protein that is made by the process of paragraph 67 or 68. 70. A use of the Pg1B oligosaccharyltransferase or functional fragment thereof of any one of paragraphs 1-51 or the polynucleotide of paragraph 52 in the production of a glycosylated carrier protein wherein the carrier protein comprises a glycosylation consensus sequence Asp/Glu-Z ₁ -Asn-Z ₂ -Ser/Thr wherein Z ₁ and Z ₂ may be any natural amino acid except Pro, wherein a saccharide is attached to the Asn residue of the glycosylation consensus sequence. 71. The use of paragraph 70 wherein the sugar residue of the saccharide which is covalently attached to the N residue of the glycosylation sequence is not an N-acetyl sugar, for example N-acetyl glucosamine. 72. The use of the Pg1B oligosaccharyltransferase of paragraph 70 or 71 wherein a glucose residue in the saccharide is covalently attached to the N residue of the glycosylation sequence. 73. The use of any one of paragraphs 70-72 wherein the saccharide is a bacterial antigen, optionally a bacterial capsular polysaccharide antigen or a bacterial O-antigen. 74. The use of any one of paragraphs 70-73 wherein the saccharide is a Gram-positive bacterial capsular polysaccharide antigen. 75. The use of any one of paragraphs 70-74 wherein the saccharide is an E. coli O antigen, a Salmonella sp antigen, a Pseudomonas sp. antigen, a Klebsiella sp antigen, a Acinetobacter O antigen, a Chlamydia trachomatis antigen, a Vibrio cholera antigen, a Listeria sp. Antigen, a Legionella pneumonia serotypes 1 to 15 antigen, a Bordetella pertussis antigen, a Bordetalla parapertussis antigen, a Burkholderia mallei or pseudomallei antigen, a Francisella tularensis antigen, a Campylobacter sp antigen, a Clostridium difficile antigen, a Streptococcus pyogenes antigen, a Streptococcus agalactiae antigen, a Enterococcus faecalis antigen, a Borrelia burgdorfei antigen, a Neisseria meningitidis antigen, a Haemophilus influenza antigen, a Leishmania major antigen, a Shigella sp. antigen, Shigella sonnei, a Staphylococcus aureus antigen, a Salmonella enterica antigen or a Streptococcus pneumoniae antigen. 76. The use of paragraph 75 wherein the saccharide is a Streptococcus pneumoniae capsular saccharide antigen. 77. The use of paragraph 76 wherein the Streptococcus pneumoniae capsular saccharide antigen is from serotype 1, 4, 19A, 22F, 23A, 35B or 8, preferably from serotype 1. 78. The use of paragraph 75 wherein the saccharide is a S. sonnei O-antigen or S. flexneri O- antigen, optionally from serotype 2a, 3a or 6. 79. The use of paragraph 75 wherein the saccharide is a S. sonnei O-antigen and the Pg1B oligosaccharyltransferase amino acid sequence includes the feature that: at least one residue selected from the group consisting of amino acids X101, X125, X315 and X570 is substituted to a different amino acid to that found at that position in SEQ ID NO:1. 80. The use of paragraph 75 wherein the saccharide is a S. sonnei O-antigen and the Pg1B oligosaccharyltransferase amino acid sequence includes the feature that: at least one residue selected from the group consisting of amino acids X195, X273, X305, X318, X477 and X570 is substituted to a different amino acid to that found at that position in SEQ ID NO:1. 81. The use of paragraph 75 wherein the saccharide is a S. sonnei O-antigen and the Pg1B oligosaccharyltransferase amino acid sequence includes the feature that: at least one residue selected from the group consisting of amino acids X195, X273, X305 and X477 is substituted to a different amino acid to that found at that position in SEQ ID NO:1. 82. The use of paragraph 81 wherein at least two, three or four residues selected from the group consisting of amino acids X195, X273, X305 and X477 are substituted to a different amino acid to that found at that position in SEQ ID NO:1. 83. The use of paragraph 75 wherein the saccharide is a S. aureus capsular saccharide. 84. The use of paragraph 83 wherein the Pg1B oligosaccharyltransferase amino acid sequence includes the feature that: at least one residue selected from the group consisting of amino acid X125, X151, X176, X199, X206, X260, X279, X281, X360 and X570 is substituted to a different amino acid to that found at that position in SEQ ID NO:1. 85. The use of any one of paragraphs 70-84 wherein the protein is a carrier protein comprising at least 1, 2 or 3 of the glycosylation consensus sequence(s). 86. The use of paragraph 85 wherein the carrier protein is Pseudomonas aeruginosa exoprotein A (EPA), diphtheria toxoid, CRM197 or tetanus toxoid. 87. The use of any one of paragraphs 70-86 wherein the Pg1B oligosaccharyltransferase or functional fragment thereof is capable of increasing the yield of glycosylation of the protein with the saccharide to produce a glycosylated protein by at least 1.5 fold, 2-fold, 3-fold, 5- fold or 10-fold compared to a corresponding Pg1B oligosaccharyltransferase which has the sequence of SEQ ID NO:1. 88. The use of any one of paragraphs 70-87 wherein the Pg1B oligosaccharyltransferase or functional fragment thereof is capable of glycosylating at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80% or 90% of the protein with a saccharide, wherein a glucose residue of the saccharide is covalently bound to the N residue of the glycosylation consensus sequence. Examples Various features and embodiments of the disclosure are illustrated in the following representative examples, which are intended to be illustrative, and not limiting. Example 1 Plasmids and strain used to assess the activity of Pg1B variants The activity of PglB variants was tested in a derivative of E. coli W3110 with deletions of genes as described in WO 14/057109A1. Capsular polysaccharide-encoding loci were stably integrated into the E. coli chromosome based on the methods detailed in WO2014057109A1. Other required elements, including PglB, carrier proteins, supplementary biosynthetic enzymes and regulatory proteins were variously expressed from plasmids pEXT21 (Spec resistant, IPTG-inducible), pEXT22 (Kan resistant, IPTG- inducible), pEC415 (Kan resistant, arabinose-inducible) or pLAFR (tet resistant, constitutive) or derivatives thereof. Plasmids: Example 2 Detection of glycosylation by ELISA from small scale cultures Variants of Pg1B were tested for their ability to catalyse the glycosylation of Exoprotein A from Pseudomonas aeruginosa (EPA) containing D/E-Z ₁ -N-Z ₂ -S/T glycosylation sites (where Z ₁ and Z ₂ are not P) using a polysaccharide corresponding to that of S. pneumoniae serotype 8. Therefore a E. coli host cell was transformed with plasmids encoding glycosyltransferase genes required for the construction of a S. pneumoniae serotype 8 capsular polysaccharide, a variant Pg1B gene and EPA containing glycosylation sites. Expression of the genes was induced using IPTG and arabinose and the E. coli host cells were grown overnight to allow expression of glycosyltransferases, Pg1B and EPA and glycosylation of EPA as follows. The wells of a 96 deep well plate were filled with 1ml of TB media and each well was inoculated with a single colony of host cell E. coli and incubated at 37 degrees C overnight. Samples of each well were used to inoculate main cultures in a 96 deep well plate containing of 1ml of TB supplemented with 10mM MgCl ₂ and appropriate antibiotics and were grown until an OD600 of 1.3-1.5 was reached. Cells were incubated with 1mM IPTG and 0.1% arabinose overnight at 37 degrees C. Periplasmic extracts were made by centrifuging the plates, removing supernatant and adding 0.2ml of 50mM Tris-HCl pH 7.5, 175mM NaCl, 5mM EDTA followed by shaking at 4 degrees C to suspend the cells.10 ^l of 10mg/ml polymyxin B was added to each well and the cells were incubated for 1 hour at 4 degrees C. The plate was centrifuged and the supernatant removed. In order to isolate the glycosylated protein from the periplasmic extract, 120 ^l of a 25% slurry of IMAC resin in 30mM Tris pH 8.0, 10mM imidazole, 500mM NaCl was added to each well of a 96 well filter plate (Acroprep Advance) and placed on top of a Nunc ELISA plate. The plate was centrifuged and the flow through discarded.150 ^l of periplasmic extract and 37.5ml of 5x binding buffer (150mM Tris pH 8.0, 50mM imidazole, 2.5M NaCl was added to each well. The samples were incubated for 30 minutes at room temperature. The plate was centrifuged and the flow through discarded and three more washing steps were carried out. Finally the glycosylated protein was eluted with 30mM Tris pH 8.0, 500mM imidazole, 200mM NaCl, ready for use in an ELISA assay. A sandwich ELISA was performed by coating the wells of a 96-well plate with an antibody that recognizes the saccharide part of the glycosylated protein (for example, a monoclonal antibody against S. pneumoniae serotype 8) diluted in PBS. The plate was incubated overnight at 4 degrees C to allow coating. The plate was then washed with PBS containing 0.1% Tween. The plate was then blocked for 2 hours at room temperature using 5% bovine serum albumin in PBST. The plate was washed in PBST. The sample was diluted in PBST containing 1% BSA and incubated in the coated wells for one hour at room temperature. After washing a detection antibody, for example anti-Histag – horseradish peroxidase diluted in PBST containing 1% BSA was added to each well and incubated for one hour at room temperature. The plate was then washed before adding 3,3’,5,5’-Tetramethylbenzidine liquid substrate, Supersensitive, for ELISA (Sigma- Aldrich). After a few minutes, the reaction was stopped by addition of 2M sulfuric acid. The results were obtained by reading the OD at 450nm. Results As a starting point, mutations were generated in a Pg1B which already contained a mutation at N311V. A first round of variant generation identified Y77R as a mutation which further increased the OST activity of Pg1B (see Figure 1). A Pg1B containing mutations at N311V and Y77R was subjected to mutation and promising variants were selected, sequenced and analysed for OST activity as described above. The fold increase in oligosaccharyltransferase activity of each variant was calculated and the results are shown in Table 3. Table 3 Improvement in engineered Pg1B OST activity in transferring S. pneumoniae 8 saccharide to a protein as determined by ELISA ROUND 2

The mutations 57T, 57R, 63L, 63Q, 94N, 101W, 101E, 101H, 101P, 101R, 101M, 101G, 172E, 176E, 176G, 191H, 191D, 101R, 101Y, 193T, 193H, 193G, 193F, 233V, 234H, 234C, 234W, 255H, 286A, 286Q, 286L, 301P, 301G, 301F, 319A, 319Q, 319L, 319T, 397N, 397L, 397Q, 402R, 402H, 425S, 435A, 435L, 435F, 435H, 435R, 446G, 462,P, 462C, 462W, 462T, 462N 479M, 523R, 532H, 601G, 605D, 606P, 610P, 610L, 610R, 610D, 610A, 645L, 645S, 645H, 676Q, 676W, 676G, 695I and 695Q were noted as mutations which appeared in several Pg1B variants which were capable of enhanced catalysis of the addition of a S. pneumoniae serotype 8 saccharide to a carrier protein. Out of these, the A57R mutation was selected as a promising mutation to take forward into further rounds due to its high increase in OST activity, its frequency of appearance in promising variants and its position in the Pg1B structure. The ability of residues 462 and 479 to synergise in order to produce higher fold increases in OST activity when both residues are mutated is demonstrated in the following table showing results for individual : In a further round of experiments, the favourable A57R mutation was added to the Y77R and N311V mutations Further mutations were added to Pg1B with A57R Y77R and N311V mutations. The new mutations were tested for increased Pg1B activity by ELISA using S. pneumoniae PS8 as the saccharide added to EPA. The results are shown in Table 4 below. Table 4 – Improvement in engineered Pg1B OST activity in transferring S. pneumoniae 8 saccharide to a protein as determined by ELISA ROUND 3 From this round, the combination of 462W and 479M was found in 52 separate Pg1B variants, producing fold increases in OST activity of up to 15 fold, or 8-12 fold where these mutations were the only new mutations present. These mutations are considered as important for improving the efficiency of Pg1B for glycosylation of proteins with saccharides containing a glucose residue at the reducing end of the saccharide. The mutations N300L, L301P, F308W and L570R were also noted as mutations which appeared in several Pg1B variants which were capable of enhanced catalysis of the addition of a S. pneumoniae serotype 8 saccharide to a carrier protein. N300L, L301P, F308W, Y462W, H479M and L570R were selected as promising mutations to take forward into further rounds of mutation/selection due to their ability to increase OST activity, their frequency of appearance in efficient Pg1B variants and their position in the molecular structure of Pg1B. These residues were added to the Y77R, N311V and A57R mutations and further point mutations were tested for their ability to improve the activity of Pg1B to add a S. pneumoniae serotype 8 saccharide to a protein. The results are shown in Table 5 below Table 5 – Improvement in engineered Pg1B OST activity in transferring S. pneumoniae 8 saccharide to a protein as determined by ELISA ROUND 4 From this round L191Y, Y286Q, S295L, A382S, K482R and T523R mutations were added to the previously tested mutations resulting in a reference Pg1B containing the following mutations: Y77R, N311V, A57R, N300L, L301P, F308W, Y462W, H479M, L570R, L191Y, Y286Q, S295L, A382S, K482R and T523R. In the next round, further mutations were tested for their ability to further increase the efficiency of a Pg1B containing Y77R, N311V, A57R, N300L, L301P, F308W, Y462W, H479M, L570R, round L191Y, Y286Q, S295L, A382S, K482R and T523R further and the results are shown in Table 6 below. Table 6 - Improvement in engineered Pg1B OST activity in transferring S. pneumoniae 8 saccharide to a protein as determined by ELISA ROUND 5 From this round a E297R was selected due to the increase in activity produced where this mutation was present and the frequency of appearance of this mutation. A S80D mutation was also selected as a promising residue due to its frequency of appearance in variants with higher levels of OST activity. Summary of evolution Over the course of this study, the activity of Pg1B in the context of adding a S. pneumoniae serotype 8 saccharide to a protein containing a glycosylation consensus sequence was increased by over three orders of magnitude (Figure 1). The introduction of A57R into a Pg1B into a Pg1B enzyme already containing Y77R and N311V mutations led to a 24 fold increase in Pg1B activity. The further addition of N300L, L301P, F308W, Y462W, H479M and L750R led to a cumulative increase in activity of 360 fold. The further incorporation of L191Y, Y286Q, S295L, A382S, K482R and T523R led to a cumulative increase of activity of 2520 fold and the further inclusion of a E297R mutation led to a cumulative 5040 fold increase in activity. Further rounds of evolution allowed small increases in Pg1B activity, however the largest increases in activity were achieved in rounds 1-3 (see Figure 1). Example 3 Measurement of Pg1B activity at shake flask volume Some of the mutated Pg1B enzymes were used in larger scale assays in order to confirm increases in activity in glycosylating an EPA protein containing 3 glycosylation consensus sequences with S. pneumoniae serotype 8 saccharide. Electrocompetent E. coli strains were transformed with the required plasmids by electroporation. The cells were allowed to recover for 1 hour and plated onto agar plates containing appropriate antibiotics and 2mM MgCl2. The plates were incubated overnight. A preculture was made by inoculating TB media containing appropriate antibiotics and 10mM MgCl ₂ with cells from the plate and incubating overnight. The main culture was started by diluting the preculture in TB medium containing appropriate antibiotics and 10mM MgCl2 to an OD600nm of 0.1. The culture was grown to an OD600nm of 0.8-1.0 and the cells were then induced using an appropriate inducer (e.g. arabinose of IPTG). The cell were then incubated overnight. A periplasmic extract was made by the following process. The culture was centrifuged to pellet the E. coli. The supernatant was discarded and the pellet resuspended in 30mM Tris- HCl pH 8.5, 1mM EDTA, 20% sucrose. Lysozyme was added to a final concentration of 1mg/ml and the cells were incubated with the lysozyme for 25 minutes at 4 degrees C with shaking. After centrifugation, the periplasmic extract was retained. 1ml of periplasmic extract was mixed with 0.25ml of 150mM Tris pH8.0, 50mM imidazole, 2.5M NaCl and 20mM MgCl2.0.2ml of a 50% slurry or pre-equilibrated NiNTA agarose (Qiagen) was added and the sample incubated for 20 minutes at room temperature with shaking. The IMAC resin was centrifuged and the supernatant discarded. 0.5ml of 30mM Tris pH 8.0, 10mM imidazole, 500mM NaCl with 0.1% n-Dodecyl-B- maltose was added, the resin centrifuged and the supernatant discarded. The resin was further washed three times with 30mM Tris pH 8.0, 10mM imidazole, 500mM NaCl. 0.2ml of elution buffer (30mM Tris pH 8.0, 10mM imidazole, 50mM NaCl) was added to the resin and incubated for 5 minutes at room temperature. The eluate was recovered and used for further analysis. The amount of glycosylation was assessed by SDS-PAGE and western blotting. After running the samples on an SDS-PAGE, the proteins were transferred to nitrocellulose membrane. The membrane was blocked with 10% milk for at least 10 minutes. After blocking the membrane was incubated with a first antibody (a mouse Mab against S. pneumoniae serotype 8 for example) in PBS-T containing 1% milk for 1 hour. After washing with PBS-T, the membrane was incubated with a second antibody - HRP conjugate (anti-mouse IgG Fc HRP) in PBS-T with 1% milk for an hour. The membrane was washed in PBS-T and developed using BioFX TMB One Component HRP membrane substrate. Results Figure 1 shows a gel in which enhanced levels of EPA glycosylated with S. pneumoniae serotype 8 capsular saccharide were obtained. The most important increases in OST activity were achieved in rounds 1-3, with smaller fold increases in activity being achieved in subsequent rounds. At a shake flask scale, yield increases of well over 1,000 fold were achieved. Example 4 The mutated Pg1B oligosaccharyltransferases show enhanced efficiency at catalyzing glycosylation with further saccharides Further experiments were carried out to investigate whether the modified Pg1B OSTs from each round could produce higher yields of further bioconjugates where different saccharides were bonded to the EPA protein. The protocols of example 2 and 3 were used to make bioconjugates of S. pneumoniae serotype 22F covalently bonded to modified EPA. The results of ELISA and western blotting show that good yields of S. pneumoniae serotype 22F-EPA conjugate could be achieved using the modified Pg1Bs generated from rounds 3, 4 and 5 of example 2. The yield using a round 3 Pg1B with mutations at A57R, Y77R and N311V is good but is improved further by using the Pg1B from round 4 which contains additional point mutations at N300L, L301P, F308W, Y462W, H479M and L570R. The yield is further improved by using the round 5 Pg1B containing further mutations at L191Y, Y286Q, S295L and A382S. The mutated Pg1B OSTs were also efficient at catalysing the addition of S. pneumoniae serotype 23A saccharide to a protein as shown in Figure 3A. The mutated Pg1B OSTs were also efficient at catalysing the addition of S. pneumoniae serotype 35B to a protein as shown in Figure 3B. The inclusion of substitutions at A57R, Y77R and N311V led to the improved activity shown in Figure 3B. The mutated Pg1B OSTs were also efficient at catalysing the addition of S. pneumoniae serotype 19A to a protein as shown in Figure 4. Example 5 Evaluation of mutated forms of Pg1B oligosaccharyltransferase for their ability to glycosylate an asparagine residue with the saccharide of S. pneumoniae serotype 1 Variants of Pg1B were tested for their ability to catalyse the glycosylation of Exoprotein A from Pseudomonas aeruginosa (EPA) containing D/E-Z ₁ -N-Z ₂ -S/T glycosylation sites (where Z1 and Z2 are not P) using a polysaccharide corresponding to that of S pneumoniae serotype 1. Therefore a E. coli host cell was transformed with plasmids encoding glycosyltransferase genes required for the construction of a S. pneumoniae serotype 1 capsular polysaccharide, a variant Pg1B gene and EPA containing glycosylation sites. Expression of the genes was induced using IPTG and arabinose and the E. coli host cells were grown overnight to allow expression of glycosyltransferases, Pg1B and EPA and glycosylation of EPA as follows. The wells of a 96 deep well plate were filled with 1ml of TB media and each well was inoculated with a single colony of host cell E. coli and incubated at 37 degrees C overnight. Samples of each well were used to inoculate main cultures in a 96 deep well plate containing of 1ml of TB supplemented with 10mM MgCl ₂ and appropriate antibiotics and were grown until an OD600 of 1.3-1.5 was reached. Cells were incubated with 1mM IPTG and 0.1% arabinose overnight at 37 degrees C. Periplasmic extracts were made by centrifuging the plates, removing supernatant and adding 0.2ml of 50mM Tris-HCl pH 7.5, 175mM NaCl, 5mM EDTA followed by shaking at 4 degrees C to suspend the cells.10 ^l of 10mg/ml polymyxin B was added to each well and the cells were incubated for 1 hour at 4 degrees C. The plate was centrifuged and the supernatant removed. In order to isolate the glycosylated protein from the periplasmic extract, 120 ^l of a 25% slurry of IMAC resin in 30mM Tris pH 8.0, 10mM imidazole, 500mM NaCl was added to each well of a 96 well filter plate (Acroprep Advance) and placed on top of a Nunc ELISA plate. The plate was centrifuged and the flow through discarded.150 ^l of periplasmic extract and 37.5ml of 5x binding buffer (150mM Tris pH 8.0, 50mM imidazole, 2.5M NaCl was added to each well. The samples were incubated for 30 minutes at room temperature. The plate was centrifuged and the flow through discarded and three more washing steps were carried out. Finally the glycosylated protein was eluted with 30mM Tris pH 8.0, 500mM imidazole, 200mM NaCl, ready for use in an ELISA assay. A sandwich ELISA was performed by coating the wells of a 96-well plate with an antibody that recognizes the saccharide part of the glycosylated protein (for example, a monoclonal antibody against S. pneumoniae serotype 1) diluted in PBS. The plate was incubated overnight at 4 degrees C to allow coating. The plate was then washed with PBS containing 0.1% Tween. The plate was then blocked for 2 hours at room temperature using 5% bovine serum albumin in PBST. The plate was washed in PBST. The sample was diluted in PBST containing 1% BSA and incubated in the coated wells for one hour at room temperature. After washing a detection antibody, for example anti-Histag – horseradish peroxidase diluted in PBST containing 1% BSA was added to each well and incubated for one hour at room temperature. The plate was then washed before adding 3,3’,5,5’-Tetramethylbenzidine liquid substrate, Supersensitive, for ELISA (Sigma- Aldrich). After a few minutes, the reaction was stopped by addition of 2M sulfuric acid. The results were obtained by reading the OD at 450nm. Results As a starting point, mutations were generated in a Pg1B which already contained a mutation at N311V. A first round of variant generation identified Y77H as a mutation which further increased the OST activity of Pg1B. A Pg1B containing mutations at N311V and Y77H was subjected to mutation and promising variants were selected, sequenced and analysed for OST activity as described above. The fold increase in oligosaccharyltransferase activity of each variant was calculated and the results are shown in Table 7. Table 7 Improvement in engineered Pg1B OST activity in transferring S. pneumoniae 1 saccharide to a protein as determined by ELISA

The mutations L204T, F489L, Y466C and F69E were selected for evaluation in larger scale cultures. Example 6 Evaluation of mutated forms of Pg1B oligosaccharyltransferase for their ability to glycosylate an asparagine residue with the saccharide of S. aureus capsular polysaccharide 5 Variants of Pg1B were tested for their ability to catalyse the glycosylation of S. aureus alpha haemolysin containing D/E-Z ₁ -N-Z ₂ -S/T glycosylation sites (where Z ₁ and Z ₂ are not P) using a polysaccharide corresponding to that of S. aureus capsular polysaccharide type 5. Therefore a E. coli host cell was transformed with plasmids encoding glycosyltransferase genes required for the construction of a S. aureus serotype 5 capsular polysaccharide, a variant Pg1B gene and alpha haemolysin containing glycosylation sites. Expression of the genes was induced using IPTG and arabinose and the E. coli host cells were grown overnight to allow expression of glycosyltransferases, Pg1B and alpha haemolysin and glycosylation of alpha haemolysin as follows. The wells of a 96 deep well plate were filled with 1ml of TB media and each well was inoculated with a single colony of host cell E. coli and incubated at 37 degrees C overnight. Samples of each well were used to inoculate main cultures in a 96 deep well plate containing of 1ml of TB supplemented with 10mM MgCl ₂ and appropriate antibiotics and were grown until an OD600 of 1.3-1.5 was reached. Cells were incubated with 1mM IPTG and 0.2% arabinose overnight at 37 degrees C. Periplasmic extracts were made by centrifuging the plates, removing supernatant and adding 02ml of 30mM Tris-HCl pH 85 1mM EDTA 20% sucrose followed by shaking at 4 degrees C to suspend the cells.20 ^l of 20mg/ml Lysozyme was added to each well and the cells were incubated for 25 minutes at 4 degrees C. The plate was centrifuged and the supernatant removed. A sandwich ELISA was performed by coating the wells of a 96-well plate with an antibody that recognizes the saccharide part of the glycosylated protein (for example, a monoclonal antibody against S. aureus capsular polysaccharide type 5) diluted in PBS. The plate was incubated overnight at 4 degrees C to allow coating. The plate was then washed with PBS containing 0.1% Tween. The plate was then blocked for 2 hours at room temperature using 5% bovine serum albumin in PBST. The plate was washed in PBST. The sample was diluted in PBST containing 1% BSA and incubated in the coated wells for one hour at room temperature. After washing a detection antibody, for example anti- Histag – horseradish peroxidase diluted in PBST containing 1% BSA was added to each well and incubated for one hour at room temperature. The plate was then washed before adding 3,3’,5,5’-Tetramethylbenzidine liquid substrate, Supersensitive, for ELISA (Sigma-Aldrich). After a few minutes, the reaction was stopped by addition of 2M sulfuric acid. The results were obtained by reading the OD at 450nm. Results As a starting point, mutations were generated in a Pg1B which already contained mutations at N311V and Y77H. A Pg1B containing mutations at N311V and Y77H was subjected to mutation and promising variants were selected, sequenced and analysed for OST activity as described above. The fold increase in oligosaccharyltransferase activity of each variant was calculated and the results are shown in Table 8. Table 8 Improvement in engineered Pg1B OST activity in transferring S. aureus capsular polysaccharide 5 to a protein as determined by ELISA Pg1B mutations at positions L233 and D282, as well as a combination of I51C and Y397G were selected for evaluation in larger cultures. Example 7 Evaluation of mutated forms of Pg1B oligosaccharyltransferase for their ability to glycosylate an asparagine residue with the saccharide of Shigella sonnei Variants of Pg1B were tested for their ability to catalyse the glycosylation of Exoprotein A from P. aeruginosa (EPA) containing D/E-Z ₁ -N-Z ₂ -S/T glycosylation sites (where Z ₁ and Z2 are not P) using a polysaccharide corresponding to that of Shigella sonnei O-antigen. Therefore a E. coli host cell was transformed with plasmids encoding glycosyltransferase genes required for the construction of a S. sonnei O-antigen, a variant Pg1B gene and EPA containing glycosylation sites. Expression of the genes was induced using IPTG and arabinose and the E. coli host cells were grown overnight to allow expression of glycosyltransferases, Pg1B and EPA and glycosylation of EPA as follows. The wells of a 96 deep well plate were filled with 1ml of TB media and each well was inoculated with a single colony of host cell E. coli and incubated at 37 degrees C overnight. Samples of each well were used to inoculate main cultures in a 96 deep well plate containing of 1ml of TB supplemented with 10mM MgCl ₂ and appropriate antibiotics and were grown until an OD600 of 1.3-1.5 was reached. Cells were incubated with 1mM IPTG and 0.1% arabinose overnight at 37 degrees C. Periplasmic extracts were made by centrifuging the plates, removing supernatant and adding 0.2ml of 50mM Tris-HCl pH 7.5, 175mM NaCl, 5mM EDTA followed by shaking at 4 degrees C to suspend the cells.10 ^l of 10mg/ml polymyxin B was added to each well and the cells were incubated for 1 hour at 4 degrees C. The plate was centrifuged and the supernatant removed. In order to isolate the glycosylated protein from the periplasmic extract, 120 μl of a 25% slurry of IMAC resin in 30mM Tris pH 8.0, 10mM imidazole, 500mM NaCl was added to each well of a 96 well filter plate (Acroprep Advance) and placed on top of a Nunc ELISA plate. The plate was centrifuged and the flow through discarded.150 μl of periplasmic extract and 37.5ml of 5x binding buffer (150mM Tris pH 8.0, 50mM imidazole, 2.5M NaCl was added to each well. The samples were incubated for 30 minutes at room temperature. The plate was centrifuged and the flow through discarded and three more washing steps were carried out. Finally the glycosylated protein was eluted with 30mM Tris pH 8.0, 500mM imidazole, 200mM NaCl, ready for use in an ELISA assay. A sandwich ELISA was performed by coating the wells of a 96-well plate with an antibody that recognizes the saccharide part of the glycosylated protein (for example, a monoclonal antibody against S. aureus capsular polysaccharide type 5) diluted in PBS. The plate was incubated overnight at 4 degrees C to allow coating. The plate was then washed with PBS containing 0.1% Tween. The plate was then blocked for 2 hours at room temperature using 5% bovine serum albumin in PBST. The plate was washed in PBST. The sample was diluted in PBST containing 1% BSA and incubated in the coated wells for one hour at room temperature. After washing a detection antibody, for example anti- Histag – horseradish peroxidase diluted in PBST containing 1% BSA was added to each well and incubated for one hour at room temperature. The plate was then washed before adding 3,3’,5,5’-Tetramethylbenzidine liquid substrate, Supersensitive, for ELISA (Sigma-Aldrich). After a few minutes, the reaction was stopped by addition of 2M sulfuric acid. The results were obtained by reading the OD at 450nm. Results As a starting point, mutations were generated in a Pg1B which already contained mutations at N311V and Y77R. A Pg1B containing mutations at N311V and Y77R was subjected to mutation and promising variants were selected, sequenced and analysed for OST activity as described above. The fold increase in oligosaccharyltransferase activity of each variant was calculated and the results are shown in Table 9. Table 9 Improvement in engineered Pg1B OST activity in transferring S. sonnei O- antigen to a protein as determined by ELISA Several point mutations in Pg1B were evaluated further in larger scale bioconjugation processes in which E. coli was grown under conditions leading to the expression of glycosyltransferases for the production of S. sonnei O-antigen, Exoprotein A carrier protein and variant Pg1B. The bioconjugates were purified and analysed by SDS-PAGE (Figure 8). The results showed that the incorporation of a point mutation at position X477 led to a 3.5 fold improvement in the yield of EPA- S. sonnei O-antigen compared to the initial Pg1B. Further point mutations that produced enhanced yields of the EPA-S. sonnei O antigen bioconjugate in multiple Pg1B variants include mutations at positions X195, X305, X273, X570 and X318. Further promising mutations which produced an increase in EPA- S. sonnei O-antigen bioconjugate yield include mutations at positions X581, X580, X450, X315, X61, X282 and X394. Example 8 Bioreactor valuation of mutated forms of Pg1B for bioconjugation of S. sonnei O-antigen A series of mutated forms of Pg1B were assessed for their ability to add a S. sonnei O- antigen to a Exoprotein A from P. aeruginosa (EPA) containing D/E-Z1-N-Z2-S/T glycosylation sites (where Z ₁ and Z ₂ are not P). Therefore a E. coli host cell was transformed with plasmids encoding glycosyltransferase genes required for the construction of a S. sonnei O-antigen, a variant Pg1B gene and EPA containing glycosylation sites. The E. coli host cell was growth in a bioreactor under conditions suitable for the expression of the glycosyltransferase, Exoprotein A and variant Pg1B. A periplasmic extraction was carried out and the EPA-S. sonnei bioconjugate isolated. The yield of EPA- S. sonnei bioconjugate was analysed by SDS-PAGE and results are shown in Figure 9. Results A 5-16 fold improvement in the yield of EPA-S. sonnei bioconjugate was observed by using a Pg1B variant containing mutations at X195, X273, X305 and X477. The results indicate that an improvement could be achieved using different amino acids at positions X305 and X477. Residue 305 was a phenylalanine in the initial Pg1B used, however, mutation to either an acidic aspartic acid residue or a basic arginine residue, led to improved activity. Similarly, at position X477 which was a glycine in the initial Pg1B, a mutation to either alanine or serine resulted in increased bioconjugate production. Sequence Listing SEQ ID NO:1 Wild type PglB from C. jejuni. (pLMTB1937) MLKKEYLKNPYLVLFAMIILAYVFSVFCRFYWVWWASEFNEYFFNNQLMIISNDGYAFAE GARDM IAGFHQPNDLSYYGSSLSALTYWLYKITPFSFESIILYMSTFLSSLVVIPTILLANEYKR PLMGFVAAL LASIANSYYNRTMSGYYDTDMLVIVLPMFILFFMVRMILKKDFFSLIALPLFIGIYLWWY PSSYTLNV ALIGLFLIYTLIFHRKEKIFYIAVILSSLTLSNIAWFYQSAIIVILFALFALEQKRLNFM IIGILGSATLIFLI LSGGVDPILYQLKFYIFRSDESANLTQGFMYFNVNQTIQEVENVDLSEFMRRISGSEIVF LFSLFGFV WLLRKHKSMIMALPILVLGFLALKGGLRFTIYSVPVMALGFGFLLSEFKAIMVKKYSQLT SNVCIVF ATILTLAPVFIHIYNYKAPTVFSQNEASLLNQLKNIANREDYVVTWWDYGYPVRYYSDVK TLVDGG KHLGKDNFFPSFALSKDEQAAANMARLSVEYTEKSFYAPQNDILKTDILQAMMKDYNQSN VDLFL ASLSKPDFKIDTPKTRDIYLYMPARMSLIFSTVASFSFINLDTGVLDKPFTFSTAYPLDV KNGEIYLSN GVVLSDDFRSFKIGDNVVSVNSIVEINSIKQGEYKITPIDDKAQFYIFYLKDSAIPYAQF ILMDKTMFN SAYVQMFFLGNYDKNLFDLVINSRDAKVFKLKI SEQ ID NO:2 PglB C. jejuni containing N311V and Y77R mutations (pLMTB4028) MLKKEYLKNPYLVLFAMIILAYVFSVFCRFYWVWWASEFNEYFFNNQLMIISNDGYAFAE GARDM IAGFHQPNDLSRYGSSLSALTYWLYKITPFSFESIILYMSTFLSSLVVIPTILLANEYKR PLMGFVAALL ASIANSYYNRTMSGYYDTDMLVIVLPMFILFFMVRMILKKDFFSLIALPLFIGIYLWWYP SSYTLNV ALIGLFLIYTLIFHRKEKIFYIAVILSSLTLSNIAWFYQSAIIVILFALFALEQKRLNFM IIGILGSATLIFLI LSGGVDPILYQLKFYIFRSDESANLTQGFMYFNVVQTIQEVENVDLSEFMRRISGSEIVF LFSLFGFV WLLRKHKSMIMALPILVLGFLALKGGLRFTIYSVPVMALGFGFLLSEFKAIMVKKYSQLT SNVCIVF ATILTLAPVFIHIYNYKAPTVFSQNEASLLNQLKNIANREDYVVTWWDYGYPVRYYSDVK TLVDGG KHLGKDNFFPSFALSKDEQAAANMARLSVEYTEKSFYAPQNDILKTDILQAMMKDYNQSN VDLFL ASLSKPDFKIDTPKTRDIYLYMPARMSLIFSTVASFSFINLDTGVLDKPFTFSTAYPLDV KNGEIYLSN GVVLSDDFRSFKIGDNVVSVNSIVEINSIKQGEYKITPIDDKAQFYIFYLKDSAIPYAQF ILMDKTMFN SAYVQMFFLGNYDKNLFDLVINSRDAKVFKLKI SEQ ID NO:3 PglB C. jejuni containing N311V and Y77H mutations MLKKEYLKNPYLVLFAMIILAYVFSVFCRFYWVWWASEFNEYFFNNQLMIISNDGYAFAE GARDM IAGFHQPNDLSHYGSSLSALTYWLYKITPFSFESIILYMSTFLSSLVVIPTILLANEYKR PLMGFVAAL LASIANSYYNRTMSGYYDTDMLVIVLPMFILFFMVRMILKKDFFSLIALPLFIGIYLWWY PSSYTLNV ALIGLFLIYTLIFHRKEKIFYIAVILSSLTLSNIAWFYQSAIIVILFALFALEQKRLNFM IIGILGSATLIFLI LSGGVDPILYQLKFYIFRSDESANLTQGFMYFNVVQTIQEVENVDLSEFMRRISGSEIVF LFSLFGFV WLLRKHKSMIMALPILVLGFLALKGGLRFTIYSVPVMALGFGFLLSEFKAIMVKKYSQLT SNVCIVF ATILTLAPVFIHIYNYKAPTVFSQNEASLLNQLKNIANREDYVVTWWDYGYPVRYYSDVK TLVDGG KHLGKDNFFPSFALSKDEQAAANMARLSVEYTEKSFYAPQNDILKTDILQAMMKDYNQSN VDLFL ASLSKPDFKIDTPKTRDIYLYMPARMSLIFSTVASFSFINLDTGVLDKPFTFSTAYPLDV KNGEIYLSN GVVLSDDFRSFKIGDNVVSVNSIVEINSIKQGEYKITPIDDKAQFYIFYLKDSAIPYAQF ILMDKTMFN SAYVQMFFLGNYDKNLFDLVINSRDAKVFKLKI SEQ ID NO:4 PglB C. jejuni with A57R, Y77R and N311V mutations (pLMTB4768) MLKKEYLKNPYLVLFAMIILAYVFSVFCRFYWVWWASEFNEYFFNNQLMIISNDGYRFAE GARDM IAGFHQPNDLSRYGSSLSALTYWLYKITPFSFESIILYMSTFLSSLVVIPTILLANEYKR PLMGFVAALL ASIANSYYNRTMSGYYDTDMLVIVLPMFILFFMVRMILKKDFFSLIALPLFIGIYLWWYP SSYTLNV ALIGLFLIYTLIFHRKEKIFYIAVILSSLTLSNIAWFYQSAIIVILFALFALEQKRLNFM IIGILGSATLIFLI LSGGVDPILYQLKFYIFRSDESANLTQGFMYFNVVQTIQEVENVDLSEFMRRISGSEIVF LFSLFGFV WLLRKHKSMIMALPILVLGFLALKGGLRFTIYSVPVMALGFGFLLSEFKAIMVKKYSQLT SNVCIVF ATILTLAPVFIHIYNYKAPTVFSQNEASLLNQLKNIANREDYVVTWWDYGYPVRYYSDVK TLVDGG KHLGKDNFFPSFALSKDEQAAANMARLSVEYTEKSFYAPQNDILKTDILQAMMKDYNQSN VDLFL ASLSKPDFKIDTPKTRDIYLYMPARMSLIFSTVASFSFINLDTGVLDKPFTFSTAYPLDV KNGEIYLSN GVVLSDDFRSFKIGDNVVSVNSIVEINSIKQGEYKITPIDDKAQFYIFYLKDSAIPYAQF ILMDKTMFN SAYVQMFFLGNYDKNLFDLVINSRDAKVFKLKI SEQ ID NO:5 PglB C. jejuni with A57R, Y77R, N300L, L301P, F308W, N311V, Y462W, H479M, L570R mutations (pLMTB5298) MLKKEYLKNPYLVLFAMIILAYVFSVFCRFYWVWWASEFNEYFFNNQLMIISNDGYRFAE GARDM IAGFHQPNDLSRYGSSLSALTYWLYKITPFSFESIILYMSTFLSSLVVIPTILLANEYKR PLMGFVAALL ASIANSYYNRTMSGYYDTDMLVIVLPMFILFFMVRMILKKDFFSLIALPLFIGIYLWWYP SSYTLNV ALIGLFLIYTLIFHRKEKIFYIAVILSSLTLSNIAWFYQSAIIVILFALFALEQKRLNFM IIGILGSATLIFLI LSGGVDPILYQLKFYIFRSDESALPTQGFMYWNVVQTIQEVENVDLSEFMRRISGSEIVF LFSLFGFV WLLRKHKSMIMALPILVLGFLALKGGLRFTIYSVPVMALGFGFLLSEFKAIMVKKYSQLT SNVCIVF ATILTLAPVFIHIYNYKAPTVFSQNEASLLNQLKNIANREDYVVTWWDYGWPVRYYSDVK TLVDG GKMLGKDNFFPSFALSKDEQAAANMARLSVEYTEKSFYAPQNDILKTDILQAMMKDYNQS NVDLF LASLSKPDFKIDTPKTRDIYLYMPARMSRIFSTVASFSFINLDTGVLDKPFTFSTAYPLD VKNGEIYLS NGVVLSDDFRSFKIGDNVVSVNSIVEINSIKQGEYKITPIDDKAQFYIFYLKDSAIPYAQ FILMDKTMF NSAYVQMFFLGNYDKNLFDLVINSRDAKVFKLKI SEQ ID NO:6 PglB C. jejuni with A57R, Y77R, L191Y, Y286Q, S295L, N300L, L301P, F308W, N311V, A382S, Y462W, H479M, K482R, T523R, L570R mutations (pLMTB5685) MLKKEYLKNPYLVLFAMIILAYVFSVFCRFYWVWWASEFNEYFFNNQLMIISNDGYRFAE GARDM IAGFHQPNDLSRYGSSLSALTYWLYKITPFSFESIILYMSTFLSSLVVIPTILLANEYKR PLMGFVAALL ASIANSYYNRTMSGYYDTDMLVIVLPMFILFFMVRMILKKDFFSLIALPLFIGIYYWWYP SSYTLNV ALIGLFLIYTLIFHRKEKIFYIAVILSSLTLSNIAWFYQSAIIVILFALFALEQKRLNFM IIGILGSATLIFLI LSGGVDPILQQLKFYIFRLDESALPTQGFMYWNVVQTIQEVENVDLSEFMRRISGSEIVF LFSLFGFV WLLRKHKSMIMALPILVLGFLALKGGLRFTIYSVPVMSLGFGFLLSEFKAIMVKKYSQLT SNVCIVF ATILTLAPVFIHIYNYKAPTVFSQNEASLLNQLKNIANREDYVVTWWDYGWPVRYYSDVK TLVDG GKMLGRDNFFPSFALSKDEQAAANMARLSVEYTEKSFYAPQNDILKRDILQAMMKDYNQS NVDLF LASLSKPDFKIDTPKTRDIYLYMPARMSRIFSTVASFSFINLDTGVLDKPFTFSTAYPLD VKNGEIYLS NGVVLSDDFRSFKIGDNVVSVNSIVEINSIKQGEYKITPIDDKAQFYIFYLKDSAIPYAQ FILMDKTMF NSAYVQMFFLGNYDKNLFDLVINSRDAKVFKLKI SEQ ID NO:7 PglB C. jejuni with A57R, Y77R, L191Y, Y286Q, S295L, E297R, N300L, L301P, F308W, N311V, A382S, Y462W, H479M, K482R, T523R, L570R mutations (pLMTB5967) MLKKEYLKNPYLVLFAMIILAYVFSVFCRFYWVWWASEFNEYFFNNQLMIISNDGYRFAE GARDM IAGFHQPNDLSRYGSSLSALTYWLYKITPFSFESIILYMSTFLSSLVVIPTILLANEYKR PLMGFVAALL ASIANSYYNRTMSGYYDTDMLVIVLPMFILFFMVRMILKKDFFSLIALPLFIGIYYWWYP SSYTLNV ALIGLFLIYTLIFHRKEKIFYIAVILSSLTLSNIAWFYQSAIIVILFALFALEQKRLNFM IIGILGSATLIFLI LSGGVDPILQQLKFYIFRLDRSALPTQGFMYWNVVQTIQEVENVDLSEFMRRISGSEIVF LFSLFGFV WLLRKHKSMIMALPILVLGFLALKGGLRFTIYSVPVMSLGFGFLLSEFKAIMVKKYSQLT SNVCIVF ATILTLAPVFIHIYNYKAPTVFSQNEASLLNQLKNIANREDYVVTWWDYGWPVRYYSDVK TLVDG GKMLGRDNFFPSFALSKDEQAAANMARLSVEYTEKSFYAPQNDILKRDILQAMMKDYNQS NVDLF LASLSKPDFKIDTPKTRDIYLYMPARMSRIFSTVASFSFINLDTGVLDKPFTFSTAYPLD VKNGEIYLS NGVVLSDDFRSFKIGDNVVSVNSIVEINSIKQGEYKITPIDDKAQFYIFYLKDSAIPYAQ FILMDKTMF NSAYVQMFFLGNYDKNLFDLVINSRDAKVFKLKI SEQ ID NO:8 PglB C. jejuni with A57R, Y77R, S80D, L191Y, Y286Q, S295L, E297R, N300L, L301P, F308W, N311V, A382S, Y462W, H479M, K482R, T523R, L570R mutations (pLMTB6274) MLKKEYLKNPYLVLFAMIILAYVFSVFCRFYWVWWASEFNEYFFNNQLMIISNDGYRFAE GARDM IAGFHQPNDLSRYGDSLSALTYWLYKITPFSFESIILYMSTFLSSLVVIPTILLANEYKR PLMGFVAAL LASIANSYYNRTMSGYYDTDMLVIVLPMFILFFMVRMILKKDFFSLIALPLFIGIYYWWY PSSYTLN VALIGLFLIYTLIFHRKEKIFYIAVILSSLTLSNIAWFYQSAIIVILFALFALEQKRLNF MIIGILGSATLIF LILSGGVDPILQQLKFYIFRLDRSALPTQGFMYWNVVQTIQEVENVDLSEFMRRISGSEI VFLFSLFGF VWLLRKHKSMIMALPILVLGFLALKGGLRFTIYSVPVMSLGFGFLLSEFKAIMVKKYSQL TSNVCIV FATILTLAPVFIHIYNYKAPTVFSQNEASLLNQLKNIANREDYVVTWWDYGWPVRYYSDV KTLVD GGKMLGRDNFFPSFALSKDEQAAANMARLSVEYTEKSFYAPQNDILKRDILQAMMKDYNQ SNVD LFLASLSKPDFKIDTPKTRDIYLYMPARMSRIFSTVASFSFINLDTGVLDKPFTFSTAYP LDVKNGEIY LSNGVVLSDDFRSFKIGDNVVSVNSIVEINSIKQGEYKITPIDDKAQFYIFYLKDSAIPY AQFILMDKT MFNSAYVQMFFLGNYDKNLFDLVINSRDAKVFKLKI SEQ ID NO:9 PglB C. jejuni with A57R, Y77R, S80D, I187V, L191Y, Y286Q, S295L, E297R, N300L, L301P, F308W, N311V, I359Q, A382S, N406I, Y462W, H479M, K482R, T523R, L570R mutations (pLMTB6526) MLKKEYLKNPYLVLFAMIILAYVFSVFCRFYWVWWASEFNEYFFNNQLMIISNDGYRFAE GARDM IAGFHQPNDLSRYGDSLSALTYWLYKITPFSFESIILYMSTFLSSLVVIPTILLANEYKR PLMGFVAAL LASIANSYYNRTMSGYYDTDMLVIVLPMFILFFMVRMILKKDFFSLIALPLFVGIYYWWY PSSYTLN VALIGLFLIYTLIFHRKEKIFYIAVILSSLTLSNIAWFYQSAIIVILFALFALEQKRLNF MIIGILGSATLIF LILSGGVDPILQQLKFYIFRLDRSALPTQGFMYWNVVQTIQEVENVDLSEFMRRISGSEI VFLFSLFGF VWLLRKHKSMIMALPQLVLGFLALKGGLRFTIYSVPVMSLGFGFLLSEFKAIMVKKYSQL TSIVCIV FATILTLAPVFIHIYNYKAPTVFSQNEASLLNQLKNIANREDYVVTWWDYGWPVRYYSDV KTLVD GGKMLGRDNFFPSFALSKDEQAAANMARLSVEYTEKSFYAPQNDILKRDILQAMMKDYNQ SNVD LFLASLSKPDFKIDTPKTRDIYLYMPARMSRIFSTVASFSFINLDTGVLDKPFTFSTAYP LDVKNGEIY LSNGVVLSDDFRSFKIGDNVVSVNSIVEINSIKQGEYKITPIDDKAQFYIFYLKDSAIPY AQFILMDKT MFNSAYVQMFFLGNYDKNLFDLVINSRDAKVFKLKI SEQ ID NO:10 Pg1B of C. jejuni MLKKEYLKNP YLVLFAMIIL AYVFSVFCRF YWVWWASEFN EYFFNNQLMI ISNDGYAFAE GARDMIAGFH QPNDLSYYGS SLSALTYWLY KITPFSFESI ILYMSTFLSS LVVIPTILLA NEYKRPLMGF VAALLASIAN SYYNRTMSGY YDTDMLVIVL PMFILFFMVR MILKKDFFSL IALPLFIGIY LWWYPSSYTL NVALIGLFLI YTLIFHRKEK IFYIAVILSS LTLSNIAWFY QSAIIVILFA LFALEQKRLN FMIIGILGSA TLIFLILSGG VDPILYQLKF YIFRSDESAN LTQGFMYFNV NQTIQEVENV DLSEFMRRIS GSEIVFLFSL FGFVWLLRKH KSMIMALPIL VLGFLALKGG LRFTIYSVPV MALGFGFLLS EFKAIMVKKY SQLTSNVCIV FATILTLAPV FIHIYNYKAP TVFSQNEASL LNQLKNIANR EDYVVTWWDY GYPVRYYSDV KTLVDGGKHL GKDNFFPSFA LSKDEQAAAN MARLSVEYTE KSFYAPQNDI LKTDILQAMM KDYNQSNVDL FLASLSKPDF KIDTPKTRDI YLYMPARMSL IFSTVASFSF INLDTGVLDK PFTFSTAYPL DVKNGEIYLS NGVVLSDDFR SFKIGDNVVS VNSIVEINSI KQGEYKITPI DDKAQFYIFY LKDSAIPYAQ FILMDKTMFN SAYVQMFFLG NYDKNLFDLV INSRDAKVFK LKIYPYDVPD YA SEQ ID NO:11 Pg1B of C. lari MKLQQNFTDN NSIKYTCILI LIAFAFSVLC RLYWVAWASE FYEFFFNDQL MITTNDGYAF AEGARDMIAG FHQPNDLSYF GSSLSTLTYW LYSILPFSFE SIILYMSAFF ASLIVVPIIL IAREYKLTTY GFIAALLGSI ANSYYNRTMS GYYDTDMLVL VLPMLILLTF IRLTINKDIF TLLLSPVFIM IYLWWYPSSY SLNFAMIGLF GLYTLVFHRK EKIFYLTIAL MIIALSMLAW QYKLALIVLL FAIFAFKEEK INFYMIWALI FISILILHLS GGLDPVLYQL KFYVFKASDV QNLKDAAFMY FNVNETIMEV NTIDPEVFMQ RISSSVLVFI LSFIGFILLC KDHKSMLLAL PMLALGFMAL RAGLRFTIYA VPVMALGFGY FLYAFFNFLE KKQIKLSLRN KNILLILIAF FSISPALMHI YYYKSSTVFT SYEASILNDL KNKAQREDYV VAWWDYGYPI RYYSDVKTLI DGGKHLGKDN FFSSFVLSKE QIPAANMARL SVEYTEKSFK ENYPDVLKAM VKDYNKTSAK DFLESLNDKD FKFDTNKTRD VYIYMPYRML RIMPVVAQFA NTNPDNGEQE KSLFFSQANA IAQDKTTGSV MLDNGVEIIN DFRALKVEGA SIPLKAFVDI ESITNGKFYY NEIDSKAQIY LLFLREYKSF VILDESLYNS SYIQMFLLNQ YDQDLFEQIT NDTRAKIYRL KR SEQ ID NO:12 MLKKEYLKNPYLVLFAMIILAYVFSVFCRFYWVWWASEFNEYFFNNQLMIISNDGYAFAE GARDM IAGFHQPNDLSHYGSSLSALTYWLYKITPFSFESIILYMSTFLSSLVVIPTILLANEYKR PLMGFVAAL LASIANSYYNRTMSGYYDTDMLVIVLPMFILFFMVRMILKKDFFSLIALPLFIGIYLWWY PSSYTLNV ALIGLFLIYTLIFHRKEKIFYIAVILSSLTLSNIAWFYQSAIIVILFALFALEQKRLNFM IIGILGSATLIFLI LSGGVDPILYQLKFYIFRSDESANLTQGFMYFNVVQTIQEVENVDLSEFMRRISGSEIVF LFSLFGFV WLLRKHKSMIMALPILVLGFLALKGGLRFTIYSVPVMALGFGFLLSEFKAIMVKKYSQLT SNVCIVF ATILTLAPVFIHIYNYKAPTVFSQNEASLLNQLKNIANREDYVVTWWDYGYPVRYYSDVK TLVDGG KHLGKDNFFPSFALSKDEQAAANMARLSVEYTEKSFYAPQNDILKTDILQAMMKDYNQSN VDLFL ASLSKPDFKIDTPKTRDIYLYMPARMSLIFSTVASFSFINLDTGVLDKPFTFSTAYPLDV KNGEIYLSN GVVLSDDFRSFKIGDNVVSVNSIVEINSIKQGEYKITPIDDKAQFYIFYLKDSAIPYAQF ILMDKTMFN SAYVQMFFLGNYDKNLFDLVINSRDAKVFKLKI